(data stored in ACNUC7421 zone)

EMBL: CP001622.PE190

CP001622.PE190       Location/Qualifiers
FT   CDS             190525..191619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0191"
FT                   /product="2-deoxycytidine 5-triphosphate deaminase"
FT                   /note="PFAM: 2-deoxycytidine 5-triphosphate deaminase;
FT                   KEGG: rec:RHECIAT_CH0000597 deoxycytidine triphosphate
FT                   deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54502"
FT                   /db_xref="GOA:C6AZH6"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZH6"
FT                   /inference="protein motif:PFAM:PF06559"
FT                   /protein_id="ACS54502.1"
FT                   /translation="MMARETGILADRAISALFETGRLISERELDRDQIQPASLDLRLGG
FT                   KAFRVRASFMPGPSHLVSDKLDRLSLHVIDLSEGAVLETGCVYIVPLMESLALPAEMSA
FT                   SANPKSSTGRLDIFTRVITDYAQEFDKIPSGYSGPLYLEISPRTFPIVVRRGSRLSQIR
FT                   FRVGQALLGEPELLKLHESETLVASKLPNVSGGGIALSIDLAGDKDGLIGYRGKHHTAV
FT                   VDVDKKAEHDLFDFWEPLHSRGRNELILDPDEFYILVSREAVHVPPDYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHAPAGGRGSRAVLEVRSHEVPFILEDGQIVGRLVYEHMQEKPA
FT                   SLYGSGLGSNYQAQGLKLSKHFRI"
     MMARETGILA DRAISALFET GRLISERELD RDQIQPASLD LRLGGKAFRV RASFMPGPSH        60
     LVSDKLDRLS LHVIDLSEGA VLETGCVYIV PLMESLALPA EMSASANPKS STGRLDIFTR       120
     VITDYAQEFD KIPSGYSGPL YLEISPRTFP IVVRRGSRLS QIRFRVGQAL LGEPELLKLH       180
     ESETLVASKL PNVSGGGIAL SIDLAGDKDG LIGYRGKHHT AVVDVDKKAE HDLFDFWEPL       240
     HSRGRNELIL DPDEFYILVS REAVHVPPDY AAEMTPFDPL VGEFRVHYAG FFDPGFGHAP       300
     AGGRGSRAVL EVRSHEVPFI LEDGQIVGRL VYEHMQEKPA SLYGSGLGSN YQAQGLKLSK       360
     HFRI                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page