(data stored in ACNUC7421 zone)

EMBL: CP001622.PE191

CP001622.PE191       Location/Qualifiers
FT   CDS             191883..193268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0192"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: oan:Oant_2329
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54503"
FT                   /db_xref="GOA:C6B084"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6B084"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS54503.1"
FT                   /translation="MAKVVGLADFDRHLTKRNGFYSYKRRVPAAIGNLDPRYPTVRVAL
FT                   GTREVGEARAKRDAHERADDLLWASLTEGGDQVAAEARYKSAVARAKALGYTYRHLPAI
FT                   LSEESGESILSRLRAVQDVKPASPQETAILGGVPRPQVSVWRALEIYIEEIVADEISGK
FT                   SPAQRELWENTKRRAVTSFVEVCGELNIDEITREHARQFYNRWREKIAPNPKSGQHATH
FT                   TPSSGNREVGNMRVLYQKYFEYMGVEDITNPFRNLSFSEKKVGQKKKKKRLPFTAEWIE
FT                   KHILKPGALARLNDQARAISLVLAETGCRPSEVANLVESQIFLDHPVPHIAIESRLDPE
FT                   DPREIKTDASVRVIPLVGVALEALKKFPKGFPRYRDKESSMSATLNKYFRENGLFPTEK
FT                   HVIYSFRHGFEDRMTVAGLDTELRMMLMGHTNSRPEYGEGGTLEWKQAQLAKIALPFDL
FT                   AIV"
     MAKVVGLADF DRHLTKRNGF YSYKRRVPAA IGNLDPRYPT VRVALGTREV GEARAKRDAH        60
     ERADDLLWAS LTEGGDQVAA EARYKSAVAR AKALGYTYRH LPAILSEESG ESILSRLRAV       120
     QDVKPASPQE TAILGGVPRP QVSVWRALEI YIEEIVADEI SGKSPAQREL WENTKRRAVT       180
     SFVEVCGELN IDEITREHAR QFYNRWREKI APNPKSGQHA THTPSSGNRE VGNMRVLYQK       240
     YFEYMGVEDI TNPFRNLSFS EKKVGQKKKK KRLPFTAEWI EKHILKPGAL ARLNDQARAI       300
     SLVLAETGCR PSEVANLVES QIFLDHPVPH IAIESRLDPE DPREIKTDAS VRVIPLVGVA       360
     LEALKKFPKG FPRYRDKESS MSATLNKYFR ENGLFPTEKH VIYSFRHGFE DRMTVAGLDT       420
     ELRMMLMGHT NSRPEYGEGG TLEWKQAQLA KIALPFDLAI V                           461
//

If you have problems or comments...

PBIL Back to PBIL home page