(data stored in ACNUC7421 zone)

EMBL: CP001622.PE192

CP001622.PE192       Location/Qualifiers
FT   CDS             complement(193698..193910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54504"
FT                   /db_xref="UniProtKB/TrEMBL:C6B085"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54504.1"
FT                   /translation="MWVFDGTVNLYRPRDPWPRSSNTWEKSRTMCVTDSDLSVEQNAEI
FT                   QALCRGVQEEPANREPRGNSPDLTR"
     MWVFDGTVNL YRPRDPWPRS SNTWEKSRTM CVTDSDLSVE QNAEIQALCR GVQEEPANRE        60
     PRGNSPDLTR                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page