(data stored in ACNUC7421 zone)

EMBL: CP001622.PE193

CP001622.PE193       Location/Qualifiers
FT   CDS             194836..196695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0194"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; peptidase
FT                   M41; SMART: AAA ATPase; KEGG: rec:RHECIAT_CH0003340
FT                   putative ATP-dependent hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54505"
FT                   /db_xref="GOA:C6B086"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:C6B086"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACS54505.1"
FT                   /translation="MYHHLDRRVFAETSSNTAKFLMLCALRQALRGTDQFKVDAKGIIV
FT                   CIVDKAWLWYAKSAANVLMTGGKVHSYYDDFRRPVHIIGESPRRTTSKGVEDSTVFRPE
FT                   HQVIYLASSLDAVRLSLQLAADVIVNILPPTARHVIAARKVLGVEDVDMPLAEAIAQQS
FT                   AEIVIGLTARNSLKGLDIATLTKPIAVPERSHKLSELPGYGPARPWVDAIKQDVADWRE
FT                   GKLPWTDVDRGILLLGAPGTGKTLFATALANELGFDLVLTSVGAWQGSNNGYLGDMLAA
FT                   MSKSFADATARRGAVLLVDELDAIGDRATMRGDHAFYEGNVIGRFLELTTHALEQPGTI
FT                   IVGATNYGHLIDNAVLRSGRLEKHVYLELPEDEERAEILAYHFNQALPAKDLREITDKL
FT                   RLVTPADLEKLARAAKRAARIRKGLLSIQDVKAILPAQVPLPEAVVHRICVHEIGHALM
FT                   AMASGSADVISIRVESHMVEGQFVQDGGRLHYKIHNEALPSDKDLLAKIRIMLGGTAAE
FT                   EVVFGNRSIGAGGVEGSDLDQATRLAYRLVGSYGLGKWLRYQMGANRVDETFVPAPELR
FT                   AEVDGILAREYRATKELLSKEKAHLMRLAAELVVDRKLLIDKK"
     MYHHLDRRVF AETSSNTAKF LMLCALRQAL RGTDQFKVDA KGIIVCIVDK AWLWYAKSAA        60
     NVLMTGGKVH SYYDDFRRPV HIIGESPRRT TSKGVEDSTV FRPEHQVIYL ASSLDAVRLS       120
     LQLAADVIVN ILPPTARHVI AARKVLGVED VDMPLAEAIA QQSAEIVIGL TARNSLKGLD       180
     IATLTKPIAV PERSHKLSEL PGYGPARPWV DAIKQDVADW REGKLPWTDV DRGILLLGAP       240
     GTGKTLFATA LANELGFDLV LTSVGAWQGS NNGYLGDMLA AMSKSFADAT ARRGAVLLVD       300
     ELDAIGDRAT MRGDHAFYEG NVIGRFLELT THALEQPGTI IVGATNYGHL IDNAVLRSGR       360
     LEKHVYLELP EDEERAEILA YHFNQALPAK DLREITDKLR LVTPADLEKL ARAAKRAARI       420
     RKGLLSIQDV KAILPAQVPL PEAVVHRICV HEIGHALMAM ASGSADVISI RVESHMVEGQ       480
     FVQDGGRLHY KIHNEALPSD KDLLAKIRIM LGGTAAEEVV FGNRSIGAGG VEGSDLDQAT       540
     RLAYRLVGSY GLGKWLRYQM GANRVDETFV PAPELRAEVD GILAREYRAT KELLSKEKAH       600
     LMRLAAELVV DRKLLIDKK                                                    619
//

If you have problems or comments...

PBIL Back to PBIL home page