(data stored in ACNUC7421 zone)

EMBL: CP001622.PE195

CP001622.PE195       Location/Qualifiers
FT   CDS             197189..199153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54507"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C6B088"
FT                   /inference="similar to AA sequence:KEGG:BBta_3314"
FT                   /protein_id="ACS54507.1"
FT                   /translation="MRLKSFSVSEFRSIIASGEITLGDVTCLVGKNEAGKTALLKALYK
FT                   LSPMSTTDARFDVTDDYPRKDLGDYQHEVDEGVRGQAVPIRATFELTDAEVSSVANLFG
FT                   PKALTSNVLTLEKSYDNRRVYSLDFNETEALKYVVSSAELESADLAAVGDVQTWKGLGN
FT                   RLAELAASPTGAKLKMLVDKINDKGSGGGYYAYNSILSRSVPEFLYFDEYYQMVGHDNV
FT                   EALIQRRDSEDLRPSDHPLLGLINLARLSLDDLISSKRTMEMVNKLEAAGNHLTRQILK
FT                   YWSQNKHLQMKFDVREAMADDPVEMRSGHNIWGRVYDQVHWATTELSSRSRGFVWFFSF
FT                   LAWYEDVKRARKNIILLLDEPGTSLHGRAQGDLLRYIEQELRPHHQVIYTTHSPFMVDP
FT                   QHFDRVRIVQDRGIDSDDPLPREEDGTKVLENVFDASDDSLFPLQGALGYDISQTLFIG
FT                   PNSLVVEGPSDLFYLRGMSSLLEREKRTGLSPEWTLTPVGGSSKIPTFVAMLAPQRGMN
FT                   VAVLVDIQASDRQTVEGLYKKKLLDQKNVHTFADFTGLVESDVEDMFERDFYVNLVNEE
FT                   FRGQLSSKITASKLNRNLPRVLRALEEHFQTSPLKSGQFGHYRPARYFAENLAVLTPKI
FT                   SEETKNRFEALFKKLNAQL"
     MRLKSFSVSE FRSIIASGEI TLGDVTCLVG KNEAGKTALL KALYKLSPMS TTDARFDVTD        60
     DYPRKDLGDY QHEVDEGVRG QAVPIRATFE LTDAEVSSVA NLFGPKALTS NVLTLEKSYD       120
     NRRVYSLDFN ETEALKYVVS SAELESADLA AVGDVQTWKG LGNRLAELAA SPTGAKLKML       180
     VDKINDKGSG GGYYAYNSIL SRSVPEFLYF DEYYQMVGHD NVEALIQRRD SEDLRPSDHP       240
     LLGLINLARL SLDDLISSKR TMEMVNKLEA AGNHLTRQIL KYWSQNKHLQ MKFDVREAMA       300
     DDPVEMRSGH NIWGRVYDQV HWATTELSSR SRGFVWFFSF LAWYEDVKRA RKNIILLLDE       360
     PGTSLHGRAQ GDLLRYIEQE LRPHHQVIYT THSPFMVDPQ HFDRVRIVQD RGIDSDDPLP       420
     REEDGTKVLE NVFDASDDSL FPLQGALGYD ISQTLFIGPN SLVVEGPSDL FYLRGMSSLL       480
     EREKRTGLSP EWTLTPVGGS SKIPTFVAML APQRGMNVAV LVDIQASDRQ TVEGLYKKKL       540
     LDQKNVHTFA DFTGLVESDV EDMFERDFYV NLVNEEFRGQ LSSKITASKL NRNLPRVLRA       600
     LEEHFQTSPL KSGQFGHYRP ARYFAENLAV LTPKISEETK NRFEALFKKL NAQL             654
//

If you have problems or comments...

PBIL Back to PBIL home page