(data stored in ACNUC7421 zone)

EMBL: CP001622.PE196

CP001622.PE196       Location/Qualifiers
FT   CDS             199362..199601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54508"
FT                   /db_xref="UniProtKB/TrEMBL:C6B089"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54508.1"
FT                   /translation="MSGYQNSFADRFALIAGEGVLSKALTDARAKFERVSEKERAERAK
FT                   LGEVRDSLARIEKIPEVQKRALSLNYVLLSAGKT"
     MSGYQNSFAD RFALIAGEGV LSKALTDARA KFERVSEKER AERAKLGEVR DSLARIEKIP        60
     EVQKRALSLN YVLLSAGKT                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page