(data stored in ACNUC7421 zone)

EMBL: CP001622.PE197

CP001622.PE197       Location/Qualifiers
FT   CDS             complement(199729..202566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc02155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54509"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="UniProtKB/TrEMBL:C6B090"
FT                   /inference="similar to AA sequence:KEGG:SMc02155"
FT                   /protein_id="ACS54509.1"
FT                   /translation="MKPWREVAVPHRDVLEGTFQQSEFAADITAVNTGKASREYQDAGA
FT                   FFDRTFITEGMALLLTQVAQRLTGRGGEPVVQLQTAFGGGKTHTMLAVYHLATRKCALS
FT                   DLAGISALVDRAGLMDVPQARVAVLDGVAHAPGQPWKRGSQTIKTLWGEMAWQLGGAEA
FT                   FALLAEADVTGTSPGKDVLRDLLERHSPCVVLIDELVAYIRQFPESQPISGGSYDSNLS
FT                   FVQALTEAAKLVPRAIVLASLPESDLEAGSQRGAAALRALEKTFGRVQALWKPVATEEA
FT                   FEIVRRRLFEPVRDEKTREGVCRAFADAYIAEGVKLPADTQERHYYDRLLHAYPIHPEV
FT                   FDRLFEDWTTIDGFQRTRGVLKLMAKVIFRLWKDDNKDLLIMPGSLPLYDGSSRNELTY
FT                   YLPAGWDAVIERDIDGDRAETTALENKEPRFGQVGAARRIARTVFLGSAPSSVASKVVA
FT                   RGIDRAHIILGCLQPGQAASVYADALGRLADRLHYLNSSGDKSHDATRFWFDTRANLRR
FT                   EMEDRKRRFDDRTEVRGKIAGALKQTVGSLTYFDGVHIFAPHGDVPDDTALRLLVLPPE
FT                   TWYARDENRLAFEAVLETIGKNGPKPRYRSNRLLFLAPDHAALSRLMDATRVALAWGSI
FT                   VEDVKEGRLNIDLLQKNQAEKELKSAEDALPRVVRECYKWLLCPMQDAATDPKPGIEAF
FT                   ALNTAGGSIAADIERVCIDNELVITTWSPIHLRTKLKELYWKGGKRAANAAGFFEDTLR
FT                   YLYMPRLKTRDVLSQAIQAGVAGKDFFGTAYGEADGKFEGFYFGGGTVIFDDTLLLIEP
FT                   QAAQAYEEANREAQPAATPPVSTATAAGGVAEAPNVYVFNGGSTSPPVAITPTSGPTKP
FT                   KTFYGSAEVPPATAKMRLVQIAEEIVSVLTSDPNATVRLVVEISAEFPDGAGDGLKRAV
FT                   SENARSLGLKSADWD"
     MKPWREVAVP HRDVLEGTFQ QSEFAADITA VNTGKASREY QDAGAFFDRT FITEGMALLL        60
     TQVAQRLTGR GGEPVVQLQT AFGGGKTHTM LAVYHLATRK CALSDLAGIS ALVDRAGLMD       120
     VPQARVAVLD GVAHAPGQPW KRGSQTIKTL WGEMAWQLGG AEAFALLAEA DVTGTSPGKD       180
     VLRDLLERHS PCVVLIDELV AYIRQFPESQ PISGGSYDSN LSFVQALTEA AKLVPRAIVL       240
     ASLPESDLEA GSQRGAAALR ALEKTFGRVQ ALWKPVATEE AFEIVRRRLF EPVRDEKTRE       300
     GVCRAFADAY IAEGVKLPAD TQERHYYDRL LHAYPIHPEV FDRLFEDWTT IDGFQRTRGV       360
     LKLMAKVIFR LWKDDNKDLL IMPGSLPLYD GSSRNELTYY LPAGWDAVIE RDIDGDRAET       420
     TALENKEPRF GQVGAARRIA RTVFLGSAPS SVASKVVARG IDRAHIILGC LQPGQAASVY       480
     ADALGRLADR LHYLNSSGDK SHDATRFWFD TRANLRREME DRKRRFDDRT EVRGKIAGAL       540
     KQTVGSLTYF DGVHIFAPHG DVPDDTALRL LVLPPETWYA RDENRLAFEA VLETIGKNGP       600
     KPRYRSNRLL FLAPDHAALS RLMDATRVAL AWGSIVEDVK EGRLNIDLLQ KNQAEKELKS       660
     AEDALPRVVR ECYKWLLCPM QDAATDPKPG IEAFALNTAG GSIAADIERV CIDNELVITT       720
     WSPIHLRTKL KELYWKGGKR AANAAGFFED TLRYLYMPRL KTRDVLSQAI QAGVAGKDFF       780
     GTAYGEADGK FEGFYFGGGT VIFDDTLLLI EPQAAQAYEE ANREAQPAAT PPVSTATAAG       840
     GVAEAPNVYV FNGGSTSPPV AITPTSGPTK PKTFYGSAEV PPATAKMRLV QIAEEIVSVL       900
     TSDPNATVRL VVEISAEFPD GAGDGLKRAV SENARSLGLK SADWD                       945
//

If you have problems or comments...

PBIL Back to PBIL home page