(data stored in ACNUC7421 zone)

EMBL: CP001622.PE198

CP001622.PE198       Location/Qualifiers
FT   CDS             complement(202580..205489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0199"
FT                   /product="protein of unknown function DUF1156"
FT                   /note="PFAM: protein of unknown function DUF1156; KEGG:
FT                   sme:SMc02154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54510"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR014455"
FT                   /db_xref="UniProtKB/TrEMBL:C6B091"
FT                   /inference="protein motif:PFAM:PF06634"
FT                   /protein_id="ACS54510.1"
FT                   /translation="MTATVKTPKKLIEVALPLDAINEACAHEKQPGIGAHPRGLHLWWA
FT                   RRPLAAARAVIFAQMVNDPSWKWELERPGDIPPNNIKASWAASRNRLFAIIKEMVKWEN
FT                   STNEAVLQKARAEILRSWRETCDLNKDHPRAAQLFDPERLPAFHDPFAGGGALPLEAQR
FT                   LGLESYASDLNPVAVLINKAMIEIPTKFAGRPPVSPVARDSQDAWSRQWAGVRGLAEDV
FT                   RHYGQWIRDQAQKRIGNLYPPVEITADMARERPDVMPLVGQRLNVLTTIWARTVKSPNP
FT                   AFRHVNVPLVSTFILSSKAGKEAYVEPIVSGDTYRLTVKVGKAPKDSDEGTKFSRGNFR
FT                   CLLSQAPISADYIRSEAKAGRMGARLLAVIAEGRNGRIYLPPTSEQEDAANKAQPLWKP
FT                   ELEFFQQALGFRIGNYGMTAWSDLFTARQLVALTTFSDLVSDVIEVIRRDAISAGVDDD
FT                   GIPLNDGGNSALAYAQAVGVYLAFAISRLADYGSSIATWKPSGEQVMQTYKRQALPMTW
FT                   DFPDSNLLGDKAICWTNAVKYAADNLLSTAAASTQAEGFAIQSDAQQQTISQNKVVSTD
FT                   PPYYDNIGYADLSDFFYVWLRKTLKPVYPELFATVAVPKAEELVATPARHGGREGAEEF
FT                   FLHGMTQAMQRLATQAHPSFPVTIYYAFKQSETQNDTGTSSTGWETFLDAVIRSGLALT
FT                   GTWPMRTELGNRMRGQESNALASSIVLVCRPRSATADTISRRVFQRELNQVLPEALDEM
FT                   TRGSGEDRSPVAPVDLSQAIIGPGMAVFSKYAAVLEADGTPMTVQTALRLINRFLAEDD
FT                   FDHDSQFCLHWFEQYGWKEGRFGEADTLARAKGTSVDGVKQSGVLLAMGGIVRLLKWAE
FT                   YPAEWDPTNDARLPVWEALHHLIRVFKTDGESGAGKVLAAIAAKAEPTRQLAYRLYTLC
FT                   ERAGWAEDARAYNEIITSWGAIESGAAMAPKARQSDLFG"
     MTATVKTPKK LIEVALPLDA INEACAHEKQ PGIGAHPRGL HLWWARRPLA AARAVIFAQM        60
     VNDPSWKWEL ERPGDIPPNN IKASWAASRN RLFAIIKEMV KWENSTNEAV LQKARAEILR       120
     SWRETCDLNK DHPRAAQLFD PERLPAFHDP FAGGGALPLE AQRLGLESYA SDLNPVAVLI       180
     NKAMIEIPTK FAGRPPVSPV ARDSQDAWSR QWAGVRGLAE DVRHYGQWIR DQAQKRIGNL       240
     YPPVEITADM ARERPDVMPL VGQRLNVLTT IWARTVKSPN PAFRHVNVPL VSTFILSSKA       300
     GKEAYVEPIV SGDTYRLTVK VGKAPKDSDE GTKFSRGNFR CLLSQAPISA DYIRSEAKAG       360
     RMGARLLAVI AEGRNGRIYL PPTSEQEDAA NKAQPLWKPE LEFFQQALGF RIGNYGMTAW       420
     SDLFTARQLV ALTTFSDLVS DVIEVIRRDA ISAGVDDDGI PLNDGGNSAL AYAQAVGVYL       480
     AFAISRLADY GSSIATWKPS GEQVMQTYKR QALPMTWDFP DSNLLGDKAI CWTNAVKYAA       540
     DNLLSTAAAS TQAEGFAIQS DAQQQTISQN KVVSTDPPYY DNIGYADLSD FFYVWLRKTL       600
     KPVYPELFAT VAVPKAEELV ATPARHGGRE GAEEFFLHGM TQAMQRLATQ AHPSFPVTIY       660
     YAFKQSETQN DTGTSSTGWE TFLDAVIRSG LALTGTWPMR TELGNRMRGQ ESNALASSIV       720
     LVCRPRSATA DTISRRVFQR ELNQVLPEAL DEMTRGSGED RSPVAPVDLS QAIIGPGMAV       780
     FSKYAAVLEA DGTPMTVQTA LRLINRFLAE DDFDHDSQFC LHWFEQYGWK EGRFGEADTL       840
     ARAKGTSVDG VKQSGVLLAM GGIVRLLKWA EYPAEWDPTN DARLPVWEAL HHLIRVFKTD       900
     GESGAGKVLA AIAAKAEPTR QLAYRLYTLC ERAGWAEDAR AYNEIITSWG AIESGAAMAP       960
     KARQSDLFG                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page