(data stored in ACNUC7421 zone)

EMBL: CP001622.PE199

CP001622.PE199       Location/Qualifiers
FT   CDS             complement(205492..206133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc04429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54511"
FT                   /db_xref="InterPro:IPR013467"
FT                   /db_xref="UniProtKB/TrEMBL:C6B092"
FT                   /inference="similar to AA sequence:KEGG:SMc04429"
FT                   /protein_id="ACS54511.1"
FT                   /translation="MWRLDRIVYPAPPCLGGYHHSTHSWQDVISGHKAEIRMHLEAMQG
FT                   RRCAYCEGDIDSLGQHIEHFRRKSLHSALTFDWDNLFWSCDQTDSCGHFKDNGAGQYDV
FT                   ADLINPCFDDPDVFFVFQADGTISIRHGLSAVDEHRARETLRILSLDAEWGRLRVMRKI
FT                   AVSGYVDDADTAFNEGWPPDDICSYFAEELECARNLPFYTAIRHVLTERQ"
     MWRLDRIVYP APPCLGGYHH STHSWQDVIS GHKAEIRMHL EAMQGRRCAY CEGDIDSLGQ        60
     HIEHFRRKSL HSALTFDWDN LFWSCDQTDS CGHFKDNGAG QYDVADLINP CFDDPDVFFV       120
     FQADGTISIR HGLSAVDEHR ARETLRILSL DAEWGRLRVM RKIAVSGYVD DADTAFNEGW       180
     PPDDICSYFA EELECARNLP FYTAIRHVLT ERQ                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page