(data stored in ACNUC7421 zone)

EMBL: CP001622.PE2

CP001622.PE2         Location/Qualifiers
FT   CDS             1743..2825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0002"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   rec:RHECIAT_CH0000398 probable saccharopine dehydrogenase
FT                   protein (NAD(+), L-lysine-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54314"
FT                   /db_xref="GOA:C6AY90"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY90"
FT                   /inference="protein motif:PFAM:PF03435"
FT                   /protein_id="ACS54314.1"
FT                   /translation="MSFEKIAVLGLGKVGRLAATLLHEGGFEVIGVDAQLPLSDVPFKC
FT                   RIGDISDPQVIGELLSNVEAVLSCLPYHLNIELARAAHLAGIHYFDLTEDVPTTNFIIE
FT                   LSKTARGLMAPQCGLAPGFVGIIGASLADGFDRCRSIRMRVGALPQHPTGLLGYAFNWS
FT                   PEGVVNEYLNDCEVIEGGVRKLVSPMEWHETVYVGGVKLEAFTTSGGLGTMCDTMLGKI
FT                   DNLDYKTMRYPGHMELMNFFFHELLMRDKRKLAGEILTNAKPPVEDDVVYVHVAAEGTE
FT                   NGSLRRKEFVRAYYPIEIAGARRTAIAWTTSASVVAVIEMVRDGLLPTTGFLHQEHIPL
FT                   EMFLKTPTGSLFKAGATSHG"
     MSFEKIAVLG LGKVGRLAAT LLHEGGFEVI GVDAQLPLSD VPFKCRIGDI SDPQVIGELL        60
     SNVEAVLSCL PYHLNIELAR AAHLAGIHYF DLTEDVPTTN FIIELSKTAR GLMAPQCGLA       120
     PGFVGIIGAS LADGFDRCRS IRMRVGALPQ HPTGLLGYAF NWSPEGVVNE YLNDCEVIEG       180
     GVRKLVSPME WHETVYVGGV KLEAFTTSGG LGTMCDTMLG KIDNLDYKTM RYPGHMELMN       240
     FFFHELLMRD KRKLAGEILT NAKPPVEDDV VYVHVAAEGT ENGSLRRKEF VRAYYPIEIA       300
     GARRTAIAWT TSASVVAVIE MVRDGLLPTT GFLHQEHIPL EMFLKTPTGS LFKAGATSHG       360
//

If you have problems or comments...

PBIL Back to PBIL home page