(data stored in ACNUC7421 zone)

EMBL: CP001622.PE20

CP001622.PE20        Location/Qualifiers
FT   CDS             complement(18450..19442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0020"
FT                   /product="Nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: bpy:Bphyt_4729 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54332"
FT                   /db_xref="GOA:C6AYA8"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA8"
FT                   /inference="protein motif:PRIAM:3.5.5.1"
FT                   /protein_id="ACS54332.1"
FT                   /translation="MTIVKAAAVQISPSLYSREETVDKVVTKIADLGDKGVQFATFPET
FT                   VVPYYPYFSFVQSAYDLRTGKEHLRLLDQSVTIPSDTTRTIAEACKRARVVVSIGVNER
FT                   DGGTIYNTQLLFDADGTLLQRRRKISPTFHERMIWGYGDGSGLRAVDSAVGRIGQLACW
FT                   EHYNPLARFALMADGEQIHSAMYPGSFGGDLFSEQMAVNIRQHALESGCFVVNATAWLD
FT                   PQQQAQVMEDTGCSIGPISSGCFTAIVAPDGSLIEEPLRSGEGVVIADLDFTLIDKRKQ
FT                   LMDSRGHYSRPELLSLLIDRTPTIHVHERITPSVPTNTAEVTEGGPALV"
     MTIVKAAAVQ ISPSLYSREE TVDKVVTKIA DLGDKGVQFA TFPETVVPYY PYFSFVQSAY        60
     DLRTGKEHLR LLDQSVTIPS DTTRTIAEAC KRARVVVSIG VNERDGGTIY NTQLLFDADG       120
     TLLQRRRKIS PTFHERMIWG YGDGSGLRAV DSAVGRIGQL ACWEHYNPLA RFALMADGEQ       180
     IHSAMYPGSF GGDLFSEQMA VNIRQHALES GCFVVNATAW LDPQQQAQVM EDTGCSIGPI       240
     SSGCFTAIVA PDGSLIEEPL RSGEGVVIAD LDFTLIDKRK QLMDSRGHYS RPELLSLLID       300
     RTPTIHVHER ITPSVPTNTA EVTEGGPALV                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page