(data stored in ACNUC7421 zone)

EMBL: CP001622.PE200

CP001622.PE200       Location/Qualifiers
FT   CDS             complement(206135..207463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc02153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54512"
FT                   /db_xref="GOA:C6B093"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C6B093"
FT                   /inference="similar to AA sequence:KEGG:SMc02153"
FT                   /protein_id="ACS54512.1"
FT                   /translation="MALRLDKLSLTNFRCFANCEIEFHSGLTVLVAQNGSGKTAVLDAA
FT                   GAALSVFVNTLYPLEKIWRIERSDVRLIPGQEHKMSPCLPVEYEAQATVQATSVTWRSA
FT                   VRTYGDKVRPSTRNLGPISMAAQPFLSDTAVLPLIAYYGTGRLWNEQRQTEYRRSSVTN
FT                   VDERVAGYADCLTSSSSFKGISAWFEHRFRQTASPLYRESLQTNLAMIEGVKTATDTVL
FT                   QPTGWSNLRWDDELHTLTAKHDGRGELPLSMLSDGVRTMLALVADVARRCASLNPQLSD
FT                   QAALKTPGVLIVDEVDMHLHPSWQQQVLGLLQSAFPALQIIVSTHSPHVLSTVEKSSIR
FT                   VLHVKNGDVVVETPLVQTRGVESADVLATVMDVDPVPALEESTALSAYRKLIEAGEAEG
FT                   QEASALRYRLNAHYGESHPVMLEADRLIRFQRFRLAKSRPESA"
     MALRLDKLSL TNFRCFANCE IEFHSGLTVL VAQNGSGKTA VLDAAGAALS VFVNTLYPLE        60
     KIWRIERSDV RLIPGQEHKM SPCLPVEYEA QATVQATSVT WRSAVRTYGD KVRPSTRNLG       120
     PISMAAQPFL SDTAVLPLIA YYGTGRLWNE QRQTEYRRSS VTNVDERVAG YADCLTSSSS       180
     FKGISAWFEH RFRQTASPLY RESLQTNLAM IEGVKTATDT VLQPTGWSNL RWDDELHTLT       240
     AKHDGRGELP LSMLSDGVRT MLALVADVAR RCASLNPQLS DQAALKTPGV LIVDEVDMHL       300
     HPSWQQQVLG LLQSAFPALQ IIVSTHSPHV LSTVEKSSIR VLHVKNGDVV VETPLVQTRG       360
     VESADVLATV MDVDPVPALE ESTALSAYRK LIEAGEAEGQ EASALRYRLN AHYGESHPVM       420
     LEADRLIRFQ RFRLAKSRPE SA                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page