(data stored in ACNUC7421 zone)

EMBL: CP001622.PE201

CP001622.PE201       Location/Qualifiers
FT   CDS             complement(207463..210975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0202"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   sme:SMc02152 putative helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54513"
FT                   /db_xref="GOA:C6B094"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C6B094"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACS54513.1"
FT                   /translation="MKLEEIKSGQSLSGIEPSQVVMVVALIPLSEGSVQLIYRTPDGGI
FT                   KERLLNRGDERTVEVASAERPFSFDGDGAAFQLACEAKRIDLAFLFDPMMAVHSSNVEP
FT                   LPHQITAVYESLLPRQPLRFVLADDPGAGKTIMAGLYIRELIMRADSHRIVIVAPGGLV
FT                   EQWRDELYEKFGLEFYVYSSLLEQTSPSGNAFDDYPRLIVRLDQLSRSEELQDKLCAPG
FT                   WDLAVFDEAHKLSAHYFGSKLEKTGRFRFAEKLGAHARHLLLMTATPHNGKEADFQLFL
FT                   SLLDSDRFYGKFRDGVHKVDASDLMRRMVKEELVKFDNTPLFPERKAYTANYQLSQIEA
FT                   SLYEAVTSYVQTEMGKADQLEGARKGSVGFALAALQRRLASSPEAIFQSLKRRRERLES
FT                   RLRGEKLGIKGRQAVAETYASAPEDDDDLSAEEQESLEENLIDDATAAKTVAELEAEIV
FT                   ILKGLEEQAKAVVASGQDRKWDELSRILQNNPEMRDASGRQRKIIIFSEHRDTLNYLQA
FT                   RIAGVLGNPDAIVTIHGGTHRDERRRLQALFRSDPDVRVLVATDAAGEGVNLQNANLMV
FT                   NYDLPWNPNRLEQRFGRIHRIGQTEVCHLWNLVAKETREGDVYHRLLLKLEVESQALHG
FT                   RVFDVLGEVFEETSLKDLLVEAIRYGDRPDVRARLTLKIDKALDHDHLKSLLNRNALAQ
FT                   ETMSPERLFAVKEEMEKAEARRLQPYFVRAFFSKALDALGGTAHPREAGRYEISHVPSA
FT                   IRERDRRQNGRNRRDHEPVLRRYSRICFERQAIQPLDRAGLERAVLMHPGHPLMLAMSD
FT                   MILEQHTNLLRQGSILVDPSDDGLDPALLFLLTHEIKSGDNTVLSKRLQFVRVGPDGKT
FT                   TFAGWAPHLDLEPLPEAERPLLKDLLDRPWLSSGHEAGALSFAATTLVPEHYGEVAQRR
FT                   IDNVEKTLNAVHERLSKEIAFWQDRWMKLRDDAVAGKDVRLNLQNVERTLGDLQGRLDN
FT                   RKKELQAMRHVVNGTPVVLGAALIVPAGLMIKLRGDEPIDPVTANFAGDAAARSRIERL
FT                   AMTAVRKAEEARGCRVVDVTAAKCGWDLTSYPPAVDGRQPDPKHIEVKGRVKGANTVTI
FT                   TRNEMLYAFNQGDKFVLAVAIVGENDVVDGPYYIPSPFDREPGWGVASINFSLGDLLAK
FT                   AEVR"
     MKLEEIKSGQ SLSGIEPSQV VMVVALIPLS EGSVQLIYRT PDGGIKERLL NRGDERTVEV        60
     ASAERPFSFD GDGAAFQLAC EAKRIDLAFL FDPMMAVHSS NVEPLPHQIT AVYESLLPRQ       120
     PLRFVLADDP GAGKTIMAGL YIRELIMRAD SHRIVIVAPG GLVEQWRDEL YEKFGLEFYV       180
     YSSLLEQTSP SGNAFDDYPR LIVRLDQLSR SEELQDKLCA PGWDLAVFDE AHKLSAHYFG       240
     SKLEKTGRFR FAEKLGAHAR HLLLMTATPH NGKEADFQLF LSLLDSDRFY GKFRDGVHKV       300
     DASDLMRRMV KEELVKFDNT PLFPERKAYT ANYQLSQIEA SLYEAVTSYV QTEMGKADQL       360
     EGARKGSVGF ALAALQRRLA SSPEAIFQSL KRRRERLESR LRGEKLGIKG RQAVAETYAS       420
     APEDDDDLSA EEQESLEENL IDDATAAKTV AELEAEIVIL KGLEEQAKAV VASGQDRKWD       480
     ELSRILQNNP EMRDASGRQR KIIIFSEHRD TLNYLQARIA GVLGNPDAIV TIHGGTHRDE       540
     RRRLQALFRS DPDVRVLVAT DAAGEGVNLQ NANLMVNYDL PWNPNRLEQR FGRIHRIGQT       600
     EVCHLWNLVA KETREGDVYH RLLLKLEVES QALHGRVFDV LGEVFEETSL KDLLVEAIRY       660
     GDRPDVRARL TLKIDKALDH DHLKSLLNRN ALAQETMSPE RLFAVKEEME KAEARRLQPY       720
     FVRAFFSKAL DALGGTAHPR EAGRYEISHV PSAIRERDRR QNGRNRRDHE PVLRRYSRIC       780
     FERQAIQPLD RAGLERAVLM HPGHPLMLAM SDMILEQHTN LLRQGSILVD PSDDGLDPAL       840
     LFLLTHEIKS GDNTVLSKRL QFVRVGPDGK TTFAGWAPHL DLEPLPEAER PLLKDLLDRP       900
     WLSSGHEAGA LSFAATTLVP EHYGEVAQRR IDNVEKTLNA VHERLSKEIA FWQDRWMKLR       960
     DDAVAGKDVR LNLQNVERTL GDLQGRLDNR KKELQAMRHV VNGTPVVLGA ALIVPAGLMI      1020
     KLRGDEPIDP VTANFAGDAA ARSRIERLAM TAVRKAEEAR GCRVVDVTAA KCGWDLTSYP      1080
     PAVDGRQPDP KHIEVKGRVK GANTVTITRN EMLYAFNQGD KFVLAVAIVG ENDVVDGPYY      1140
     IPSPFDREPG WGVASINFSL GDLLAKAEVR                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page