(data stored in ACNUC7421 zone)

EMBL: CP001622.PE202

CP001622.PE202       Location/Qualifiers
FT   CDS             complement(211311..213323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0203"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   rsh:Rsph17029_3200 ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54514"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B095"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ACS54514.1"
FT                   /translation="MSRDDRKRAIGKIVSVAADRFVVEMHSGTDNFTVVGFDDVHYVAR
FT                   LGSFLMVPVQDEYVVVEVVGLRERDSGNPGHGSGDMDKAASAKYLDVVPVGMLPQVRGA
FT                   KFRFGVSIYPSLYADALYALDAELDRVFETEVVTEQPPDPGGQALPTRYNALSIGRSVV
FT                   FEGYDVKVKIDEFFGAHTAVLGNTGSGKSCTISSVLQSLFQKPDEHRARGATFIVFDVN
FT                   GEYWQSLSPLAADEGIGVSRLVLDGSAEPGRFRLPHWFLDQTEWELLLQASERTQMPVL
FT                   RTALGLTGLFRKDSPEALLVKEHFMARCIIECFRGADGDSPVSKFHRVVSLLQRYPTKD
FT                   LNLALLRAYGANFQFGNFANNNLVPFLEKVGEKVREEIKLPSYDRTPFAFDDLEECLDF
FT                   AILYEESHGNRQIRDYCSQMVTRLKSLKERSDFRFLRHELPTEGDAPTTGTFLKTLLGL
FT                   REAGPGGKLIKDAQIVVVDMNDVEDEVVELVSSVLARMTFRLLRQADPRNRFPVHLLLE
FT                   EAHRYISETPSRFAIDAHRIYERIAKEGRKYGLFLLVASQRPSELSKTVLSQCSNFVVH
FT                   RIQNPDDLSQIRQMTPFISDAVLKRLPSLPKQHALVFGTSVNLPTTFRVRNADPLPKSD
FT                   DAKIRDLWFHGADRAAGISFSQSSAPPGLLESEAC"
     MSRDDRKRAI GKIVSVAADR FVVEMHSGTD NFTVVGFDDV HYVARLGSFL MVPVQDEYVV        60
     VEVVGLRERD SGNPGHGSGD MDKAASAKYL DVVPVGMLPQ VRGAKFRFGV SIYPSLYADA       120
     LYALDAELDR VFETEVVTEQ PPDPGGQALP TRYNALSIGR SVVFEGYDVK VKIDEFFGAH       180
     TAVLGNTGSG KSCTISSVLQ SLFQKPDEHR ARGATFIVFD VNGEYWQSLS PLAADEGIGV       240
     SRLVLDGSAE PGRFRLPHWF LDQTEWELLL QASERTQMPV LRTALGLTGL FRKDSPEALL       300
     VKEHFMARCI IECFRGADGD SPVSKFHRVV SLLQRYPTKD LNLALLRAYG ANFQFGNFAN       360
     NNLVPFLEKV GEKVREEIKL PSYDRTPFAF DDLEECLDFA ILYEESHGNR QIRDYCSQMV       420
     TRLKSLKERS DFRFLRHELP TEGDAPTTGT FLKTLLGLRE AGPGGKLIKD AQIVVVDMND       480
     VEDEVVELVS SVLARMTFRL LRQADPRNRF PVHLLLEEAH RYISETPSRF AIDAHRIYER       540
     IAKEGRKYGL FLLVASQRPS ELSKTVLSQC SNFVVHRIQN PDDLSQIRQM TPFISDAVLK       600
     RLPSLPKQHA LVFGTSVNLP TTFRVRNADP LPKSDDAKIR DLWFHGADRA AGISFSQSSA       660
     PPGLLESEAC                                                              670
//

If you have problems or comments...

PBIL Back to PBIL home page