(data stored in ACNUC7421 zone)

EMBL: CP001622.PE203

CP001622.PE203       Location/Qualifiers
FT   CDS             complement(213320..214357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsh:Rsph17029_3199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54515"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C6B096"
FT                   /inference="similar to AA sequence:KEGG:Rsph17029_3199"
FT                   /protein_id="ACS54515.1"
FT                   /translation="MVRELDDPAFPTKAERTAMLELFGIQIEADEYARNLERLMELLFS
FT                   MRFVLKRSSHETTADGIKLVEGIITKVQAFLWERCTNGVFATGDGTVRGFYETFYRKLV
FT                   LRDRSLPRPWVFTTNYDVFNETAMDRLGLPYANGFSGVVERRFNPATFRYALAEQLDVS
FT                   SRKWSAVDGFVYLCKLHGSITWTEDDHGLFPIREMAPGKQPGKVMIYPTPAKQNSSLGS
FT                   PYSDLFREFQSRVVREQSVLFTMGYAFGDEHINNIIYQALTIPTFRLVIFVDPELGGEI
FT                   AKLRALEDPRIWIIGGDGREKGQKAHYFDTIVEEFMPQRPTERIDEAVRKVLETMGAAS
FT                   RGEAE"
     MVRELDDPAF PTKAERTAML ELFGIQIEAD EYARNLERLM ELLFSMRFVL KRSSHETTAD        60
     GIKLVEGIIT KVQAFLWERC TNGVFATGDG TVRGFYETFY RKLVLRDRSL PRPWVFTTNY       120
     DVFNETAMDR LGLPYANGFS GVVERRFNPA TFRYALAEQL DVSSRKWSAV DGFVYLCKLH       180
     GSITWTEDDH GLFPIREMAP GKQPGKVMIY PTPAKQNSSL GSPYSDLFRE FQSRVVREQS       240
     VLFTMGYAFG DEHINNIIYQ ALTIPTFRLV IFVDPELGGE IAKLRALEDP RIWIIGGDGR       300
     EKGQKAHYFD TIVEEFMPQR PTERIDEAVR KVLETMGAAS RGEAE                       345
//

If you have problems or comments...

PBIL Back to PBIL home page