(data stored in ACNUC7421 zone)

EMBL: CP001622.PE204

CP001622.PE204       Location/Qualifiers
FT   CDS             complement(215709..216218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0205"
FT                   /product="protein of unknown function DUF995"
FT                   /note="PFAM: protein of unknown function DUF995; KEGG:
FT                   smd:Smed_3668 protein of unknown function DUF995"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54516"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:C6B097"
FT                   /inference="protein motif:PFAM:PF06191"
FT                   /protein_id="ACS54516.1"
FT                   /translation="MSMLQKMFLAVVLTGGIATAASAAGTNEPAGIETAKPMSSAEIYR
FT                   LYNQNSWMWKAGAGYFSAKARRFTAWSRENGSPSFGTGRWFITETGKLCFNADWHAKTG
FT                   TATAITCFSHRKKGGLIYQKREPDGEWYVFKSAPAQATDEFAKLRRGDYVRSQLGGIEM
FT                   SVSKTR"
     MSMLQKMFLA VVLTGGIATA ASAAGTNEPA GIETAKPMSS AEIYRLYNQN SWMWKAGAGY        60
     FSAKARRFTA WSRENGSPSF GTGRWFITET GKLCFNADWH AKTGTATAIT CFSHRKKGGL       120
     IYQKREPDGE WYVFKSAPAQ ATDEFAKLRR GDYVRSQLGG IEMSVSKTR                   169
//

If you have problems or comments...

PBIL Back to PBIL home page