(data stored in ACNUC7421 zone)

EMBL: CP001622.PE205

CP001622.PE205       Location/Qualifiers
FT   CDS             complement(216237..217202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0206"
FT                   /product="putative cellulase H precursor protein"
FT                   /note="KEGG: sme:SM_b20462 putative cellulase H precursor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54517"
FT                   /db_xref="GOA:C6B098"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:C6B098"
FT                   /inference="similar to AA sequence:KEGG:SM_b20462"
FT                   /protein_id="ACS54517.1"
FT                   /translation="MHSPSKIALLSLTGLLLSGVAVLPTALGSSAEGQPLAMTTSSIAP
FT                   PTKMPVVTKESITFGAYDPHGDLGASPDSKIEHLFLPWEDVDLRTLALADDYAQARGRT
FT                   LLISVEPWTWSTGSRQTSQELLHSILNGSRDANMAAVCSTAAKLKSPVIIRWGQEMDET
FT                   DSQFSWSHWQGDDYAKAYRRMVEVCKVHLKTAKYMWSPKGNEGLQAFYPGNDVVDLIGL
FT                   SVFGLEQYDRDKTGRDQTFAEHLAPGYARVAGYGKPIMVAELGYEGGDSFVRNWAESVT
FT                   KRYPQFPALSAVVYFNDREVYPWPDGYGRPDWRIVRESIN"
     MHSPSKIALL SLTGLLLSGV AVLPTALGSS AEGQPLAMTT SSIAPPTKMP VVTKESITFG        60
     AYDPHGDLGA SPDSKIEHLF LPWEDVDLRT LALADDYAQA RGRTLLISVE PWTWSTGSRQ       120
     TSQELLHSIL NGSRDANMAA VCSTAAKLKS PVIIRWGQEM DETDSQFSWS HWQGDDYAKA       180
     YRRMVEVCKV HLKTAKYMWS PKGNEGLQAF YPGNDVVDLI GLSVFGLEQY DRDKTGRDQT       240
     FAEHLAPGYA RVAGYGKPIM VAELGYEGGD SFVRNWAESV TKRYPQFPAL SAVVYFNDRE       300
     VYPWPDGYGR PDWRIVRESI N                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page