(data stored in ACNUC7421 zone)

EMBL: CP001622.PE206

CP001622.PE206       Location/Qualifiers
FT   CDS             complement(217195..219102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0207"
FT                   /product="putative cellulose synthase protein"
FT                   /note="KEGG: sme:SM_b20460 putative cellulose synthase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54518"
FT                   /db_xref="GOA:C6B099"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B099"
FT                   /inference="similar to AA sequence:KEGG:SM_b20460"
FT                   /protein_id="ACS54518.1"
FT                   /translation="MTELAIIQATHAPEPSHEPLLVPVLTGHRRTEYLFSAAVWACAFA
FT                   YFWIWWLEPRHHVDAFGTITVSLVLAWVTALPAYFIVVFYRAARPNGPLRLPAGSRVAM
FT                   VVTKAPAEPFSVVSETLLAMLAQEVEHDTWLADEDPSPETLDWCSRHGVLVSTRKGRSD
FT                   YHRTSWPRRTRCKEGNLAFFYDHYGYSRYDFVAQLDADHVPAPDYLFHMLRPFGDPKVG
FT                   YVSAPSICDKNASESWSARGRLYAEASMHGSLQAGYNGGLAPMCIGSHYAVRTVALKQI
FT                   GGLGPELAEDHSTTLMMNAGGWRGVHALDAIAHGDGPRTFSDLVTQEFQWSRSLVMVLL
FT                   RYSPSLLGRLPARLKFQFLFSQLWYPLFAFFMLLMFALPIIALVRGQNFVTVTYPDFLA
FT                   HFAPLSIALVVMAYRWRASSSFRPYDAKILSWECMLFLFARWPWALAGTLAAVHDFVTG
FT                   SFVDFRVTPKGRSEVDLLPVRVLAPYAVLALMAVLPALAIADAGASKGGYFFTILNAAI
FT                   YCALLLVIVGRHSKENTVAAAPRFYRPAMATVLLALVALPGAATIMRGKDATEALAWGS
FT                   GRLQLFEERYAASGAGRGGTALRTIFFKPRWISDPEEIQLRTDAAHPDVRPSVEEVHNA
FT                   "
     MTELAIIQAT HAPEPSHEPL LVPVLTGHRR TEYLFSAAVW ACAFAYFWIW WLEPRHHVDA        60
     FGTITVSLVL AWVTALPAYF IVVFYRAARP NGPLRLPAGS RVAMVVTKAP AEPFSVVSET       120
     LLAMLAQEVE HDTWLADEDP SPETLDWCSR HGVLVSTRKG RSDYHRTSWP RRTRCKEGNL       180
     AFFYDHYGYS RYDFVAQLDA DHVPAPDYLF HMLRPFGDPK VGYVSAPSIC DKNASESWSA       240
     RGRLYAEASM HGSLQAGYNG GLAPMCIGSH YAVRTVALKQ IGGLGPELAE DHSTTLMMNA       300
     GGWRGVHALD AIAHGDGPRT FSDLVTQEFQ WSRSLVMVLL RYSPSLLGRL PARLKFQFLF       360
     SQLWYPLFAF FMLLMFALPI IALVRGQNFV TVTYPDFLAH FAPLSIALVV MAYRWRASSS       420
     FRPYDAKILS WECMLFLFAR WPWALAGTLA AVHDFVTGSF VDFRVTPKGR SEVDLLPVRV       480
     LAPYAVLALM AVLPALAIAD AGASKGGYFF TILNAAIYCA LLLVIVGRHS KENTVAAAPR       540
     FYRPAMATVL LALVALPGAA TIMRGKDATE ALAWGSGRLQ LFEERYAASG AGRGGTALRT       600
     IFFKPRWISD PEEIQLRTDA AHPDVRPSVE EVHNA                                  635
//

If you have problems or comments...

PBIL Back to PBIL home page