(data stored in ACNUC7421 zone)

EMBL: CP001622.PE207

CP001622.PE207       Location/Qualifiers
FT   CDS             complement(219099..220085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0208"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: sme:SM_b20459 putative UDP-glucose
FT                   4-epimerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54519"
FT                   /db_xref="GOA:C6B0A0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A0"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACS54519.1"
FT                   /translation="MDAPRVLVTGGAGYIGSHTAKLLRSEGIEPVVYDNLTTGNRSSVR
FT                   WGPFVEGDVLDTSCLIEVIEKYAPDAVIHFAASAYVGESVENPAKYYNNNVCGALSLID
FT                   ACRQTGLQNVIFSSSCAVYGVPSVLPIDETLPKAPINPYGKTKLIFEHMLADYAAAYGL
FT                   RYVALRYFNACGADPDGELGEWHVPETHLIPRALLAAAGRIPHLEIFGDDYDTPDGTCI
FT                   RDYIHVADLARAHVQAFTHLAKGGANLAVNLGTGRGYSIREVLRVIQETTGCEVPVVIH
FT                   PRRPGDPPSLYADASLARETLCFQPRYSDLETIVRTAAPFFGLEVRA"
     MDAPRVLVTG GAGYIGSHTA KLLRSEGIEP VVYDNLTTGN RSSVRWGPFV EGDVLDTSCL        60
     IEVIEKYAPD AVIHFAASAY VGESVENPAK YYNNNVCGAL SLIDACRQTG LQNVIFSSSC       120
     AVYGVPSVLP IDETLPKAPI NPYGKTKLIF EHMLADYAAA YGLRYVALRY FNACGADPDG       180
     ELGEWHVPET HLIPRALLAA AGRIPHLEIF GDDYDTPDGT CIRDYIHVAD LARAHVQAFT       240
     HLAKGGANLA VNLGTGRGYS IREVLRVIQE TTGCEVPVVI HPRRPGDPPS LYADASLARE       300
     TLCFQPRYSD LETIVRTAAP FFGLEVRA                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page