(data stored in ACNUC7421 zone)

EMBL: CP001622.PE208

CP001622.PE208       Location/Qualifiers
FT   CDS             complement(220085..221131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0209"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: sme:SM_b20458 putative dTDP-glucose
FT                   4,6-dehydratase protein; SNP /replace=T"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54520"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54520.1"
FT                   /translation="MNYLGKIRARSVQVSARDANCPSGIHRAPKRVLVTGGAGFLGSHL
FT                   CETLLAAGHQVICLDNFSTGMRRNIVHLKRVDRFNVVAHDIVHPLDLEVDEIYNLACPA
FT                   SPPHYQADPIHTTKTCVLGSLNLLELAARTGARILQASTSEVYGDPNVHPQVESYWGNV
FT                   NSFGPRSCYDEGKRCAETLFFDFHNTHGVEIKIIRIFNTYGPRMRPDDGRVVSNFIVQA
FT                   LTGQDITIYGDGSQTRSFCFVDDLIGGMVRMMASPSSLTGPVNLGNPGEFTIRELAEQV
FT                   IGLTGSRSQIIHRALPVDDPRQRRPDISLAMQELDWRPKIDLSSGLRQTIDYFDGVLTR
FT                   PARELEAV"
     MNYLGKIRAR SVQVSARDAN CPSGIHRAPK RVLVTGGAGF LGSHLCETLL AAGHQVICLD        60
     NFSTGMRRNI VHLKRVDRFN VVAHDIVHPL DLEVDEIYNL ACPASPPHYQ ADPIHTTKTC       120
     VLGSLNLLEL AARTGARILQ ASTSEVYGDP NVHPQVESYW GNVNSFGPRS CYDEGKRCAE       180
     TLFFDFHNTH GVEIKIIRIF NTYGPRMRPD DGRVVSNFIV QALTGQDITI YGDGSQTRSF       240
     CFVDDLIGGM VRMMASPSSL TGPVNLGNPG EFTIRELAEQ VIGLTGSRSQ IIHRALPVDD       300
     PRQRRPDISL AMQELDWRPK IDLSSGLRQT IDYFDGVLTR PARELEAV                    348
//

If you have problems or comments...

PBIL Back to PBIL home page