(data stored in ACNUC7421 zone)

EMBL: CP001622.PE209

CP001622.PE209       Location/Qualifiers
FT   CDS             221486..222634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0210"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ret:RHE_PE00361 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54521"
FT                   /db_xref="GOA:C6B0A2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS54521.1"
FT                   /translation="MATGSESDDDPAAEQERPAHMERRRWPREPAMRKERPPHASPALV
FT                   PLRFSTQDLPPAEQFQAWRAHMAPLVDVHLPEGKSPEDGFLAEQIGWHLGDILIVQQRA
FT                   HAHRYVRDQAMLRSSPIDHWNVGLQRSGQAWTEVNRRVTETGAGEIFFMSLGSPYRGRT
FT                   TDTEALLVFLPYEMLARDASLLQSAGNTVLSGSHAELLTGYLTGLETNLGNLTIEEVPR
FT                   IIQTIGDMVVAGAASSTRTDTGQNQANMGLMERAHRYIHVNLHSENLTPDVMCRALGIS
FT                   RTRLYQLFEASGGVLNYIRKRRLLQAYADLSNSADHRPISEIAEAAGFEVAANFTRAFI
FT                   HEFGLSPREIRRTMATQQRPAPAIRSTRRYEKTIGDWLALTG"
     MATGSESDDD PAAEQERPAH MERRRWPREP AMRKERPPHA SPALVPLRFS TQDLPPAEQF        60
     QAWRAHMAPL VDVHLPEGKS PEDGFLAEQI GWHLGDILIV QQRAHAHRYV RDQAMLRSSP       120
     IDHWNVGLQR SGQAWTEVNR RVTETGAGEI FFMSLGSPYR GRTTDTEALL VFLPYEMLAR       180
     DASLLQSAGN TVLSGSHAEL LTGYLTGLET NLGNLTIEEV PRIIQTIGDM VVAGAASSTR       240
     TDTGQNQANM GLMERAHRYI HVNLHSENLT PDVMCRALGI SRTRLYQLFE ASGGVLNYIR       300
     KRRLLQAYAD LSNSADHRPI SEIAEAAGFE VAANFTRAFI HEFGLSPREI RRTMATQQRP       360
     APAIRSTRRY EKTIGDWLAL TG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page