(data stored in ACNUC7421 zone)

EMBL: CP001622.PE21

CP001622.PE21        Location/Qualifiers
FT   CDS             complement(19503..20096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54333"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54333.1"
FT                   /translation="MQRRTLLTLGTGLAVSVLTGFRPAATTTETHHRPAGLWFADMEPD
FT                   GLTRTYRRYRLLLVGQRDDAVASDLSESAVEVLERFLPASRARLIRAADTRRVGVLIGT
FT                   RQQDIAIMTRESAEALFAAGPPFADIRNLPLRLIVSFDSHVLVSRTDFPDSHAYAVAQT
FT                   LTEHKNLLPRPAVAPDGLIPVHRGAHAYFTGETI"
     MQRRTLLTLG TGLAVSVLTG FRPAATTTET HHRPAGLWFA DMEPDGLTRT YRRYRLLLVG        60
     QRDDAVASDL SESAVEVLER FLPASRARLI RAADTRRVGV LIGTRQQDIA IMTRESAEAL       120
     FAAGPPFADI RNLPLRLIVS FDSHVLVSRT DFPDSHAYAV AQTLTEHKNL LPRPAVAPDG       180
     LIPVHRGAHA YFTGETI                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page