(data stored in ACNUC7421 zone)

EMBL: CP001622.PE211

CP001622.PE211       Location/Qualifiers
FT   CDS             223497..223877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0212"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00531 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54523"
FT                   /db_xref="GOA:C6B0A4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54523.1"
FT                   /translation="MRLNHLDFHVPDIAATADFFIRHFGLRLKDMRGQNGLAILEDDTG
FT                   LEIVLSHAIAKFGTADQVEMGRQTYHIGFILPERADVDAVHAGLAAAGAALSGRPAAMR
FT                   GGWLFYCTAPGNILVEIGWRPG"
     MRLNHLDFHV PDIAATADFF IRHFGLRLKD MRGQNGLAIL EDDTGLEIVL SHAIAKFGTA        60
     DQVEMGRQTY HIGFILPERA DVDAVHAGLA AAGAALSGRP AAMRGGWLFY CTAPGNILVE       120
     IGWRPG                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page