(data stored in ACNUC7421 zone)

EMBL: CP001622.PE212

CP001622.PE212       Location/Qualifiers
FT   CDS             complement(224243..224782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecl:EcolC_3640 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54524"
FT                   /db_xref="GOA:C6B0A5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54524.1"
FT                   /translation="MKIRPEVLDHWPEVRERLPDLFAALAAQQEQEGEVQVRVHEGMTG
FT                   TPPPPPLVLRLIVRRKDPQQAQAEQERLLKDARKRGKKPDPRSLEAAKYILLLTSLPTA
FT                   TFPPADILTLYRFRWQIELAFKRFKSLAGLDSLPAKKPELARAWLYARLIVAIIAEQIA
FT                   GQVPDSPPSGCGNPTG"
     MKIRPEVLDH WPEVRERLPD LFAALAAQQE QEGEVQVRVH EGMTGTPPPP PLVLRLIVRR        60
     KDPQQAQAEQ ERLLKDARKR GKKPDPRSLE AAKYILLLTS LPTATFPPAD ILTLYRFRWQ       120
     IELAFKRFKS LAGLDSLPAK KPELARAWLY ARLIVAIIAE QIAGQVPDSP PSGCGNPTG        179
//

If you have problems or comments...

PBIL Back to PBIL home page