(data stored in ACNUC7421 zone)

EMBL: CP001622.PE213

CP001622.PE213       Location/Qualifiers
FT   CDS             complement(224903..226894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0214"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: ret:RHE_CH00532 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54525"
FT                   /db_xref="GOA:C6B0A6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54525.1"
FT                   /translation="MLKHLKIRTKIISVVALMGLITMAGLIYVISEFRRADAAYSAFID
FT                   HEAQASMLSARASASAVASVLQVTLIADMKPDTPAFQTALATPSKLPQARDRMKQALAL
FT                   VPSRKPAIDEIQAGIDEIETLANKIIEQSKAKDSAGALSNVALINAKLDALTPKMIANN
FT                   DAMMAMLNDGGDALSASVNGRIVFCFVLIGIAVLAAVGFSVVVAQKGIAGPMTQLRLRM
FT                   TRLAEGDTTSDVSGLDRGDEVGQMAKAVSVFRDNAIERARIEARAETDRDVSDSERRDR
FT                   EAQKAREASELDRAVTALGDGLRRLAAGDLASHIAEPFVAHLDALREDFNNSVEKLNET
FT                   LHTVGANARAIGAGANEIRSSADQLSQRTEQQSASVEETAAALEEITTTVRDAAKRAEE
FT                   ASQLVARARLGAEKSGEVVRKAVSAMQQIEKSSGEISNIIGVIDDIAFQTNLLALNAGV
FT                   EAARAGDAGKGFAVVAQEVRELAQRSAKAAKEIKALISTSGSHVQTGVSLVGETGKALD
FT                   AIVQEVQEINQHVHAIAEASREQSIGLQEINTAVNTMDQGTQQNAAMVEESTAASHNLA
FT                   TEASALNNLLGQFRLTGTGGFTTSTPIAAAAPRAAARPAARAAPVRVAREGTARPAASP
FT                   ARALGQKIANAFGAGSTSPSQDPDWTEF"
     MLKHLKIRTK IISVVALMGL ITMAGLIYVI SEFRRADAAY SAFIDHEAQA SMLSARASAS        60
     AVASVLQVTL IADMKPDTPA FQTALATPSK LPQARDRMKQ ALALVPSRKP AIDEIQAGID       120
     EIETLANKII EQSKAKDSAG ALSNVALINA KLDALTPKMI ANNDAMMAML NDGGDALSAS       180
     VNGRIVFCFV LIGIAVLAAV GFSVVVAQKG IAGPMTQLRL RMTRLAEGDT TSDVSGLDRG       240
     DEVGQMAKAV SVFRDNAIER ARIEARAETD RDVSDSERRD REAQKAREAS ELDRAVTALG       300
     DGLRRLAAGD LASHIAEPFV AHLDALREDF NNSVEKLNET LHTVGANARA IGAGANEIRS       360
     SADQLSQRTE QQSASVEETA AALEEITTTV RDAAKRAEEA SQLVARARLG AEKSGEVVRK       420
     AVSAMQQIEK SSGEISNIIG VIDDIAFQTN LLALNAGVEA ARAGDAGKGF AVVAQEVREL       480
     AQRSAKAAKE IKALISTSGS HVQTGVSLVG ETGKALDAIV QEVQEINQHV HAIAEASREQ       540
     SIGLQEINTA VNTMDQGTQQ NAAMVEESTA ASHNLATEAS ALNNLLGQFR LTGTGGFTTS       600
     TPIAAAAPRA AARPAARAAP VRVAREGTAR PAASPARALG QKIANAFGAG STSPSQDPDW       660
     TEF                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page