(data stored in ACNUC7421 zone)

EMBL: CP001622.PE214

CP001622.PE214       Location/Qualifiers
FT   CDS             227472..228347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0215"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   rec:RHECIAT_CH0000603 probable amino acid ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54526"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A7"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS54526.1"
FT                   /translation="MMQSKLASLTLKGFLAFGLFFGVLFSSLAASAQQVSPSLPLLFDA
FT                   RERLARPDLSSLVRLRFLTSVDFPPFNFTDQNGKLSGFNVDLAREICSELEISDKCQIQ
FT                   AIPFADLRDALAASQGDAVIAGFAVTPELRRQFVFSRPYLMLPARFVRNLAVPLDGKTA
FT                   SALSSHPVGVVRGTVHEAMLAAFFPTLKAEPFDTKDALLAALRDRKVDAAFADALQLSF
FT                   WVSSPASAKCCALFDGPYLSEHFLGEGMTIMLRQKDSVLTSAIDHALATLSRNGRLQEI
FT                   YLRYFPYGLY"
     MMQSKLASLT LKGFLAFGLF FGVLFSSLAA SAQQVSPSLP LLFDARERLA RPDLSSLVRL        60
     RFLTSVDFPP FNFTDQNGKL SGFNVDLARE ICSELEISDK CQIQAIPFAD LRDALAASQG       120
     DAVIAGFAVT PELRRQFVFS RPYLMLPARF VRNLAVPLDG KTASALSSHP VGVVRGTVHE       180
     AMLAAFFPTL KAEPFDTKDA LLAALRDRKV DAAFADALQL SFWVSSPASA KCCALFDGPY       240
     LSEHFLGEGM TIMLRQKDSV LTSAIDHALA TLSRNGRLQE IYLRYFPYGL Y                291
//

If you have problems or comments...

PBIL Back to PBIL home page