(data stored in ACNUC7421 zone)

EMBL: CP001622.PE215

CP001622.PE215       Location/Qualifiers
FT   CDS             complement(228380..228793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54527"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A8"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00534"
FT                   /protein_id="ACS54527.1"
FT                   /translation="MNKPLSAHDALIYVMVMASAVDSTMNDREMERIGQLIGFLPVFRD
FT                   FDDDKLIAVARDCASLLAGPEGLDVVLETVRDTLPAKLYDTAYALAVEVASADLSVKAE
FT                   ELRLLSLLRDRLGLDKLTCAAIERSAIARFRKG"
     MNKPLSAHDA LIYVMVMASA VDSTMNDREM ERIGQLIGFL PVFRDFDDDK LIAVARDCAS        60
     LLAGPEGLDV VLETVRDTLP AKLYDTAYAL AVEVASADLS VKAEELRLLS LLRDRLGLDK       120
     LTCAAIERSA IARFRKG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page