(data stored in ACNUC7421 zone)

EMBL: CP001622.PE216

CP001622.PE216       Location/Qualifiers
FT   CDS             complement(228896..229606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54528"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0A9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000605"
FT                   /protein_id="ACS54528.1"
FT                   /translation="MRPAAFITGITGMVVVTGLLLAGEARLGGGTAGEETASAEETATA
FT                   AVDAASDADEGAAISDDRAEMIARSTEPAASPSPAPGDGVTSKPADLPQQADTAAGQTA
FT                   SPSAKKAVELARPMVDNAGMLSFGERRLQLAGIVPTPVDRICGPAGRQWPCGMMAKTAL
FT                   RLLLRNRSVSCDLETVEWKDTVTTACRLGTEDLGAWLAENGWAEAAVGSPLTAAAEKAR
FT                   QAGKGLYGDDPRRH"
     MRPAAFITGI TGMVVVTGLL LAGEARLGGG TAGEETASAE ETATAAVDAA SDADEGAAIS        60
     DDRAEMIARS TEPAASPSPA PGDGVTSKPA DLPQQADTAA GQTASPSAKK AVELARPMVD       120
     NAGMLSFGER RLQLAGIVPT PVDRICGPAG RQWPCGMMAK TALRLLLRNR SVSCDLETVE       180
     WKDTVTTACR LGTEDLGAWL AENGWAEAAV GSPLTAAAEK ARQAGKGLYG DDPRRH           236
//

If you have problems or comments...

PBIL Back to PBIL home page