(data stored in ACNUC7421 zone)

EMBL: CP001622.PE217

CP001622.PE217       Location/Qualifiers
FT   CDS             complement(229618..230295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0218"
FT                   /product="putative phage repressor"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000606 putative phage-related
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54529"
FT                   /db_xref="GOA:C6B0B0"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B0"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACS54529.1"
FT                   /translation="MLSHNQIWEALDRLAERHELTPSGLARRAGLDPTSFNKSKRLSAD
FT                   GRLRWPSTESIAKVLDATGASMEQFMAFMRPDAGLSKQPAGQQENAFPPQGGSIPLLGF
FT                   AQAGAGGFFDDGGFPAGQGWDVVEFPAAPSQKAGVYALEVQGESMMPLYRDGDVLIVEP
FT                   GAQVRRNDRVVVRTNEGEVMAKVLLRQSPRSIELLSLNPEHPNRTLELSDVDWIARIIW
FT                   ASQ"
     MLSHNQIWEA LDRLAERHEL TPSGLARRAG LDPTSFNKSK RLSADGRLRW PSTESIAKVL        60
     DATGASMEQF MAFMRPDAGL SKQPAGQQEN AFPPQGGSIP LLGFAQAGAG GFFDDGGFPA       120
     GQGWDVVEFP AAPSQKAGVY ALEVQGESMM PLYRDGDVLI VEPGAQVRRN DRVVVRTNEG       180
     EVMAKVLLRQ SPRSIELLSL NPEHPNRTLE LSDVDWIARI IWASQ                       225
//

If you have problems or comments...

PBIL Back to PBIL home page