(data stored in ACNUC7421 zone)

EMBL: CP001622.PE218

CP001622.PE218       Location/Qualifiers
FT   CDS             complement(230418..231065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0219"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   rec:RHECIAT_CH0000607 probable two-component response
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54530"
FT                   /db_xref="GOA:C6B0B1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS54530.1"
FT                   /translation="MHEQTIIIADDHPLFRDALRQAVIGMEGRQSIVEAGDFAAARRAA
FT                   GAHADADLMLLDLAMPGVSGFSGLMALRSEFASLPIVIVSATDDATTIRRALELGASGF
FT                   ISKSSGIDDIRRGIQTVLAGDIATPESYRDGQEQDPDVADLIHRLHTLTPQQSRVLTML
FT                   GEGLLNKQIAYELGVSEATIKAHVSAILLKLDVDSRTQAVIQLGKINMAMVA"
     MHEQTIIIAD DHPLFRDALR QAVIGMEGRQ SIVEAGDFAA ARRAAGAHAD ADLMLLDLAM        60
     PGVSGFSGLM ALRSEFASLP IVIVSATDDA TTIRRALELG ASGFISKSSG IDDIRRGIQT       120
     VLAGDIATPE SYRDGQEQDP DVADLIHRLH TLTPQQSRVL TMLGEGLLNK QIAYELGVSE       180
     ATIKAHVSAI LLKLDVDSRT QAVIQLGKIN MAMVA                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page