(data stored in ACNUC7421 zone)

EMBL: CP001622.PE22

CP001622.PE22        Location/Qualifiers
FT   CDS             complement(20099..21478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0022"
FT                   /product="Formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: swi:Swit_0965
FT                   formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54334"
FT                   /db_xref="GOA:C6AYB0"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB0"
FT                   /inference="protein motif:PRIAM:3.5.1.49"
FT                   /protein_id="ACS54334.1"
FT                   /translation="MNSRIDYRKTSAAVSRNFNGFQEPLQKISKWAAVPRIPAHCVRSK
FT                   FACAAPAVAMFLVGSGAFADTSDVKGPRPVIVAKSGEHCKDDPNCFNRVHYAVKPVARV
FT                   KPGQKFILETRDGLDSDLDFSSTAEDVAAVDLNRCHPLTGPVYIEGAKKGDSIAVTVVD
FT                   IEPDEFGTTTVVPGFGFLRDLFTDPYIVHWDLNRLEARSKDMPGISVPNNSFMGTIGVL
FT                   PDKEELQKWLKREQELADAGGAVLTPQPVEALPADLCGVDGTAKSECLRTVPPRENGGN
FT                   VDARETIVGTTILLPCFIDGCGLFAGDVHFAMGGGEVAGTAIETGGRVTLEAQVRPGGA
FT                   KLQTTMHFEGGSQLKQLAPSSFYAISGLPVKSEGELPVFETYLGGEKIAPLANLSEDLT
FT                   LAARNATLNMIDFLVKTKGLTREQAYVLTSVAVDLNIAQVVDYPNVGVTAILNRDVFKE
FT                   Q"
     MNSRIDYRKT SAAVSRNFNG FQEPLQKISK WAAVPRIPAH CVRSKFACAA PAVAMFLVGS        60
     GAFADTSDVK GPRPVIVAKS GEHCKDDPNC FNRVHYAVKP VARVKPGQKF ILETRDGLDS       120
     DLDFSSTAED VAAVDLNRCH PLTGPVYIEG AKKGDSIAVT VVDIEPDEFG TTTVVPGFGF       180
     LRDLFTDPYI VHWDLNRLEA RSKDMPGISV PNNSFMGTIG VLPDKEELQK WLKREQELAD       240
     AGGAVLTPQP VEALPADLCG VDGTAKSECL RTVPPRENGG NVDARETIVG TTILLPCFID       300
     GCGLFAGDVH FAMGGGEVAG TAIETGGRVT LEAQVRPGGA KLQTTMHFEG GSQLKQLAPS       360
     SFYAISGLPV KSEGELPVFE TYLGGEKIAP LANLSEDLTL AARNATLNMI DFLVKTKGLT       420
     REQAYVLTSV AVDLNIAQVV DYPNVGVTAI LNRDVFKEQ                              459
//

If you have problems or comments...

PBIL Back to PBIL home page