(data stored in ACNUC7421 zone)

EMBL: CP001622.PE220

CP001622.PE220       Location/Qualifiers
FT   CDS             231692..232045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0221"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   ret:RHE_CH00539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54532"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B3"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ACS54532.1"
FT                   /translation="MTLTPTLYKIVTETLWQQARQTGTFHGAGIDLQDGFIHFSTADQV
FT                   KQTAALHFAGQSGLLLIAVDGGGFSDKLVFEPSRGGDLFPHLYADLPLAAVLWEAPLPL
FT                   DEAGAHVFPELQP"
     MTLTPTLYKI VTETLWQQAR QTGTFHGAGI DLQDGFIHFS TADQVKQTAA LHFAGQSGLL        60
     LIAVDGGGFS DKLVFEPSRG GDLFPHLYAD LPLAAVLWEA PLPLDEAGAH VFPELQP          117
//

If you have problems or comments...

PBIL Back to PBIL home page