(data stored in ACNUC7421 zone)

EMBL: CP001622.PE221

CP001622.PE221       Location/Qualifiers
FT   CDS             232042..233130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0222"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="KEGG: ret:RHE_CH00540 dihydroorotate dehydrogenase
FT                   2; TIGRFAM: dihydroorotate dehydrogenase; PFAM:
FT                   dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54533"
FT                   /db_xref="GOA:C6B0B4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B4"
FT                   /inference="protein motif:TFAM:TIGR01036"
FT                   /protein_id="ACS54533.1"
FT                   /translation="MIDPFKRLARKGLFLFDPETAHGMSIAALKSGLVPACQITPDPRL
FT                   RQTVAGLTFENPLGMAAGYDKNAEVPEALLKLGFGFTEIGTVTPKPQSGNPRPRIFRLV
FT                   EDEAVINRLGFNNEGHDAAFGHLAALRGGGMIGVNIGANKDSEDRIADYVAGIRRFYSV
FT                   ARYFTANISSPNTPGLRDLQGRESLAVLLSAVLAARDEMAAASGRTIPVFLKIAPDLTE
FT                   EGMDDIAAEALSHGLDGLIVSNTTLSRDGLKDQRQAKEAGGLSGVPLFEKSTAVLARMR
FT                   KRVGPDLPIIGVGGVSSAETALEKIRAGADLVQLYSCMVYEGPGLAGDIVRGLSKLLDR
FT                   EKAASIRDLRDVRLDYWAARKV"
     MIDPFKRLAR KGLFLFDPET AHGMSIAALK SGLVPACQIT PDPRLRQTVA GLTFENPLGM        60
     AAGYDKNAEV PEALLKLGFG FTEIGTVTPK PQSGNPRPRI FRLVEDEAVI NRLGFNNEGH       120
     DAAFGHLAAL RGGGMIGVNI GANKDSEDRI ADYVAGIRRF YSVARYFTAN ISSPNTPGLR       180
     DLQGRESLAV LLSAVLAARD EMAAASGRTI PVFLKIAPDL TEEGMDDIAA EALSHGLDGL       240
     IVSNTTLSRD GLKDQRQAKE AGGLSGVPLF EKSTAVLARM RKRVGPDLPI IGVGGVSSAE       300
     TALEKIRAGA DLVQLYSCMV YEGPGLAGDI VRGLSKLLDR EKAASIRDLR DVRLDYWAAR       360
     KV                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page