(data stored in ACNUC7421 zone)

EMBL: CP001622.PE222

CP001622.PE222       Location/Qualifiers
FT   CDS             complement(233106..234452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0223"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: ret:RHE_CH00541
FT                   DNA-damage-inducible F protein (Na+ driven multidrug efflux
FT                   pump)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54534"
FT                   /db_xref="GOA:C6B0B5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B5"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACS54534.1"
FT                   /translation="MDTRSNHNALAFDVTHLMVLSIALPMTLGFMTTPLLGLTNTAVVG
FT                   RMGNAEALAGLAIGAMLFDLILGSFNFLRASTTGLTAQAYGRHDQHEQQAVFFRAMISA
FT                   LGCGLALLCLSPLLMTAGLRLMGAEGAIAEATSTYFSIRMLAAPAALANYAILGFVLGR
FT                   GQGKIGLLLQAIINGINILLSIYLGLTLDWGVAGVAWGTMAGESVGALAGLFIVLNGFG
FT                   KAARPAWAEIFSRHRLAELFALNRDILIRTFVLIGAFTIMTRIGTSFGAVTLAANAVVM
FT                   NFFLLSGYYLDGLANAAEQIIGRAIGAHYRPAFDRGLKLTTLWSFGLAALGSAVFFLAG
FT                   PWLISVLTTSPDVRQAAETYLPWAAVTGLTGALAFVMDGVFIGATWSADMRNRMLISFA
FT                   GYLMMLAIFVPLFGNHGLWLAMNAFLLFRGFFLAMLVRSRADQTFRAAQ"
     MDTRSNHNAL AFDVTHLMVL SIALPMTLGF MTTPLLGLTN TAVVGRMGNA EALAGLAIGA        60
     MLFDLILGSF NFLRASTTGL TAQAYGRHDQ HEQQAVFFRA MISALGCGLA LLCLSPLLMT       120
     AGLRLMGAEG AIAEATSTYF SIRMLAAPAA LANYAILGFV LGRGQGKIGL LLQAIINGIN       180
     ILLSIYLGLT LDWGVAGVAW GTMAGESVGA LAGLFIVLNG FGKAARPAWA EIFSRHRLAE       240
     LFALNRDILI RTFVLIGAFT IMTRIGTSFG AVTLAANAVV MNFFLLSGYY LDGLANAAEQ       300
     IIGRAIGAHY RPAFDRGLKL TTLWSFGLAA LGSAVFFLAG PWLISVLTTS PDVRQAAETY       360
     LPWAAVTGLT GALAFVMDGV FIGATWSADM RNRMLISFAG YLMMLAIFVP LFGNHGLWLA       420
     MNAFLLFRGF FLAMLVRSRA DQTFRAAQ                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page