(data stored in ACNUC7421 zone)

EMBL: CP001622.PE223

CP001622.PE223       Location/Qualifiers
FT   CDS             complement(234538..235035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0224"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG:
FT                   rec:RHECIAT_CH0000612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54535"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B6"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ACS54535.1"
FT                   /translation="MTSIDLSRRGLLRLSGLALAAGIAGCTTTPRMAGTPSDGEDETAS
FT                   VLPLVNQLRAKNGLPPLTVDPAASTAALFQAKRMASAGKMAHLMGMTDSFGARVKASGV
FT                   RLPAAENIASGQQSVDAVVTAWINSPHHLENMLGRYGGLGVAVAHNTSSRNLPYWAMVL
FT                   SS"
     MTSIDLSRRG LLRLSGLALA AGIAGCTTTP RMAGTPSDGE DETASVLPLV NQLRAKNGLP        60
     PLTVDPAAST AALFQAKRMA SAGKMAHLMG MTDSFGARVK ASGVRLPAAE NIASGQQSVD       120
     AVVTAWINSP HHLENMLGRY GGLGVAVAHN TSSRNLPYWA MVLSS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page