(data stored in ACNUC7421 zone)

EMBL: CP001622.PE225

CP001622.PE225       Location/Qualifiers
FT   CDS             235505..236440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0226"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_2 repeat
FT                   protein; KEGG: rec:RHECIAT_CH0000614 probable
FT                   methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54537"
FT                   /db_xref="GOA:C6B0B8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACS54537.1"
FT                   /translation="MQPHQLSSGDVIADRRADYARMLEEGGEPEAAAELMEQALELVPA
FT                   WAAGWYRLATYLEKAGRGEAAIEAYRRTLALGPDDIFGAALKLALLGDGAVPPDRPPSR
FT                   YVERLFDDYADRFESALVEKLDYSVPQKLAALIASTGRRYERAVDLGCGTGLLGPEIRA
FT                   NVDRLEGFDLSQNMLAKAAEKHVYDSLAQADLSLAPDLSVVFADAARHRADLVTAADVL
FT                   MYLGNLESVFAIVGELAASGADIAFSVEDAGEGDGFHLAPSLRYAHSESYVRMLLARHG
FT                   FQILKTVKSVIRKDGGKPVSGILFLTQKPA"
     MQPHQLSSGD VIADRRADYA RMLEEGGEPE AAAELMEQAL ELVPAWAAGW YRLATYLEKA        60
     GRGEAAIEAY RRTLALGPDD IFGAALKLAL LGDGAVPPDR PPSRYVERLF DDYADRFESA       120
     LVEKLDYSVP QKLAALIAST GRRYERAVDL GCGTGLLGPE IRANVDRLEG FDLSQNMLAK       180
     AAEKHVYDSL AQADLSLAPD LSVVFADAAR HRADLVTAAD VLMYLGNLES VFAIVGELAA       240
     SGADIAFSVE DAGEGDGFHL APSLRYAHSE SYVRMLLARH GFQILKTVKS VIRKDGGKPV       300
     SGILFLTQKP A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page