(data stored in ACNUC7421 zone)

EMBL: CP001622.PE226

CP001622.PE226       Location/Qualifiers
FT   CDS             236652..237287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0227"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   ret:RHE_CH00545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54538"
FT                   /db_xref="GOA:C6B0B9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0B9"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACS54538.1"
FT                   /translation="MTQLINALGFWNTTATRHTPIEDVQGIFSGSLVAALGLYVLASAG
FT                   LLTGSTAGVAFLLHYAFGVNFGLAFFLLNLPFFYLSWKRLGMAFTIKTFIAIGLTSVIA
FT                   DVQSRFLSISSIHPAWAALLGGLLLGFGLLALYRHRASLGGVGILGIYLQERFGIRAGL
FT                   VQLAIDMCVLAAAFFVTTPPVVFYSVLGAVVLNLFVAINHRADRYIAL"
     MTQLINALGF WNTTATRHTP IEDVQGIFSG SLVAALGLYV LASAGLLTGS TAGVAFLLHY        60
     AFGVNFGLAF FLLNLPFFYL SWKRLGMAFT IKTFIAIGLT SVIADVQSRF LSISSIHPAW       120
     AALLGGLLLG FGLLALYRHR ASLGGVGILG IYLQERFGIR AGLVQLAIDM CVLAAAFFVT       180
     TPPVVFYSVL GAVVLNLFVA INHRADRYIA L                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page