(data stored in ACNUC7421 zone)

EMBL: CP001622.PE228

CP001622.PE228       Location/Qualifiers
FT   CDS             complement(237674..238135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0229"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rec:RHECIAT_CH0000617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54540"
FT                   /db_xref="GOA:C6B0C1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C1"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACS54540.1"
FT                   /translation="MQPRFNFAKAAPDAYKAVAALEQYVQSSGLERRFIHLIKLRASQI
FT                   NGCAYCVDMHVKEARHDGLSEQWINLMCVWRESPVYDARERALLGWVDSVTNIAKTGAP
FT                   DADYETLKAHFSEEEMTKITVAIGAINIWNRLAVGFRSQHPLDAAAKAA"
     MQPRFNFAKA APDAYKAVAA LEQYVQSSGL ERRFIHLIKL RASQINGCAY CVDMHVKEAR        60
     HDGLSEQWIN LMCVWRESPV YDARERALLG WVDSVTNIAK TGAPDADYET LKAHFSEEEM       120
     TKITVAIGAI NIWNRLAVGF RSQHPLDAAA KAA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page