(data stored in ACNUC7421 zone)

EMBL: CP001622.PE229

CP001622.PE229       Location/Qualifiers
FT   CDS             complement(238158..238658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0230"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; Helix-turn-helix
FT                   type 11 domain protein; KEGG: rec:RHECIAT_CH0000618
FT                   putative transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54541"
FT                   /db_xref="GOA:C6B0C2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C2"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACS54541.1"
FT                   /translation="MKIGDGVEQAIHSVAMLSGLSEGGVLSAAALAEFHGVSTSYLLKH
FT                   LQALSGAGILDTVPGPKGGYRLAKAPKEISLLDIVLAVEGSAPAFRCAEIRQRGPNPVS
FT                   DRLFAQPCTINAAMLKAERVYRAELAKTSLADIGIELAAVDDGSIAARGCAFLEIHERK
FT                   TAR"
     MKIGDGVEQA IHSVAMLSGL SEGGVLSAAA LAEFHGVSTS YLLKHLQALS GAGILDTVPG        60
     PKGGYRLAKA PKEISLLDIV LAVEGSAPAF RCAEIRQRGP NPVSDRLFAQ PCTINAAMLK       120
     AERVYRAELA KTSLADIGIE LAAVDDGSIA ARGCAFLEIH ERKTAR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page