(data stored in ACNUC7421 zone)

EMBL: CP001622.PE23

CP001622.PE23        Location/Qualifiers
FT   CDS             complement(22088..22723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0023"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   sbl:Sbal_4073 (acyl-carrier-protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54335"
FT                   /db_xref="GOA:C6AYB1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB1"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACS54335.1"
FT                   /translation="MRVLHVSCSPRGEASESYRLSQQIISQLRQSDPDTTVIDRVIGQG
FT                   VIPPIDEDYAVSQGSSKDVSQLGSMAKSEELILELETADVVVISTPMHNLTLPATLKLW
FT                   IDHIVRTRRTFNISKFGKVGTLQDRPVFVAISSGGRFSGEHPQQPDFLTPYLTAILGMI
FT                   GLHNVAIFSVQGTGSHVNELASIRRNTDQLVREHFASFHPDLIAVPTY"
     MRVLHVSCSP RGEASESYRL SQQIISQLRQ SDPDTTVIDR VIGQGVIPPI DEDYAVSQGS        60
     SKDVSQLGSM AKSEELILEL ETADVVVIST PMHNLTLPAT LKLWIDHIVR TRRTFNISKF       120
     GKVGTLQDRP VFVAISSGGR FSGEHPQQPD FLTPYLTAIL GMIGLHNVAI FSVQGTGSHV       180
     NELASIRRNT DQLVREHFAS FHPDLIAVPT Y                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page