(data stored in ACNUC7421 zone)

EMBL: CP001622.PE230

CP001622.PE230       Location/Qualifiers
FT   CDS             238791..239423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0231"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   rec:RHECIAT_CH0000619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54542"
FT                   /db_xref="GOA:C6B0C3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C3"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACS54542.1"
FT                   /translation="MASNAFAGLLNSSADRHSLFDDAQGIVAGSMLAVLGVTLLSSAGL
FT                   LAGGTAGLAFLAHYATGFSFGLCFFVVNLPFYYLAFRRLGLAFTIKTFAAIALTSVLSE
FT                   FISGFVSMAHVDPIAGALFGGLVIGAGMLALFRHRASLGGIGILALYIQDRLGWRAGFV
FT                   QLGFDGTILALSFFVASPFIIACSVLGAIVLNLTIAINHRKDRYIAM"
     MASNAFAGLL NSSADRHSLF DDAQGIVAGS MLAVLGVTLL SSAGLLAGGT AGLAFLAHYA        60
     TGFSFGLCFF VVNLPFYYLA FRRLGLAFTI KTFAAIALTS VLSEFISGFV SMAHVDPIAG       120
     ALFGGLVIGA GMLALFRHRA SLGGIGILAL YIQDRLGWRA GFVQLGFDGT ILALSFFVAS       180
     PFIIACSVLG AIVLNLTIAI NHRKDRYIAM                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page