(data stored in ACNUC7421 zone)

EMBL: CP001622.PE231

CP001622.PE231       Location/Qualifiers
FT   CDS             239420..241981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0232"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: DEAD/H associated domain protein; DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000620 ATP-dependent RNA/DNA helicase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54543"
FT                   /db_xref="GOA:C6B0C4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C4"
FT                   /inference="protein motif:PFAM:PF08494"
FT                   /protein_id="ACS54543.1"
FT                   /translation="MKARGSSFSLAFHYLPGVDQIDSEARTLLPAAFTRWFAEKGWRPR
FT                   AHQLELLARAEAGESTLLIAPTGAGKTLAGFLPSLTDLTRRGKIPPGSAFTGIHTLYVS
FT                   PLKALAIDIERNLMKPVEEMGLPVTVENRTGDTPNAKRQRQKLNPPDILLTTPEQVALL
FT                   LANREAERFFKDLKYIVLDELHSLVTSKRGHMLSLGLARLRRLAPGLKTIGLSATVAEP
FT                   MDLQKWLVGQEEGGEHHAGLVVVEGGAKPDISILSTEERIPWAGHSARYAIPDVYNKLV
FT                   EHRTTLLFVNTRSQAEMLFQALWTINDDNLPIALHHGSLDVAQRRKVEAAMAENRLRAV
FT                   VATSTLDLGIDWGDVDLVIHVGAPKGASRLAQRIGRANHRMDEPSKAILVPANRFEVME
FT                   CQAALDANYIGAQDTPPVGRGALDVLAQHVLGMACAEPFDMLELYDEIISASPYADLSW
FT                   ETFERIIDFVATGGYALRTYERYARIRKTAEGRWRVSNPAVAQQYRLNLGTIVESPMLN
FT                   IRMVKRGEGGRIGRGGATLGKVEEYFLEQMSPGDTFVFSGKVLRFEGIRENECLASQAF
FT                   SLDPKIPSYNGGKFPLSTYLAEQVRAMIADPDRWRRLPDQVRDWLSLQNDKSMLPKRDE
FT                   FLIETFPRGSRGYMVAYPFEGRLAHQTLGMLLTRRLERIGAKPLGFVATDYSLAVWGLE
FT                   DMGLMIRNGRLNLSDLFDEDMLGDDLEAWLDESFLLKRTFRNCAVIAGLIERRHPGKEK
FT                   SGRQITVSADLIYDVLRSHEPDHILLQATRQDAATGLLDIGRLGDMLRRIRGHITHRAL
FT                   DHISPLAVPVMLEIGREAVPGEAHDALLAEAADDLIAEALA"
     MKARGSSFSL AFHYLPGVDQ IDSEARTLLP AAFTRWFAEK GWRPRAHQLE LLARAEAGES        60
     TLLIAPTGAG KTLAGFLPSL TDLTRRGKIP PGSAFTGIHT LYVSPLKALA IDIERNLMKP       120
     VEEMGLPVTV ENRTGDTPNA KRQRQKLNPP DILLTTPEQV ALLLANREAE RFFKDLKYIV       180
     LDELHSLVTS KRGHMLSLGL ARLRRLAPGL KTIGLSATVA EPMDLQKWLV GQEEGGEHHA       240
     GLVVVEGGAK PDISILSTEE RIPWAGHSAR YAIPDVYNKL VEHRTTLLFV NTRSQAEMLF       300
     QALWTINDDN LPIALHHGSL DVAQRRKVEA AMAENRLRAV VATSTLDLGI DWGDVDLVIH       360
     VGAPKGASRL AQRIGRANHR MDEPSKAILV PANRFEVMEC QAALDANYIG AQDTPPVGRG       420
     ALDVLAQHVL GMACAEPFDM LELYDEIISA SPYADLSWET FERIIDFVAT GGYALRTYER       480
     YARIRKTAEG RWRVSNPAVA QQYRLNLGTI VESPMLNIRM VKRGEGGRIG RGGATLGKVE       540
     EYFLEQMSPG DTFVFSGKVL RFEGIRENEC LASQAFSLDP KIPSYNGGKF PLSTYLAEQV       600
     RAMIADPDRW RRLPDQVRDW LSLQNDKSML PKRDEFLIET FPRGSRGYMV AYPFEGRLAH       660
     QTLGMLLTRR LERIGAKPLG FVATDYSLAV WGLEDMGLMI RNGRLNLSDL FDEDMLGDDL       720
     EAWLDESFLL KRTFRNCAVI AGLIERRHPG KEKSGRQITV SADLIYDVLR SHEPDHILLQ       780
     ATRQDAATGL LDIGRLGDML RRIRGHITHR ALDHISPLAV PVMLEIGREA VPGEAHDALL       840
     AEAADDLIAE ALA                                                          853
//

If you have problems or comments...

PBIL Back to PBIL home page