(data stored in ACNUC7421 zone)

EMBL: CP001622.PE232

CP001622.PE232       Location/Qualifiers
FT   CDS             242024..242749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0233"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   rec:RHECIAT_CH0000621 putative phosphoesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54544"
FT                   /db_xref="GOA:C6B0C5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS54544.1"
FT                   /translation="MNRLALARDISGLAAIPGIETSVNGIAAVCDPLGALYLPDAGLLV
FT                   VSDLHLEKGAAFARRGMMLPPYDTLATLTVLAAVISRYDPKLVISLGDNFHDRIGSKHL
FT                   PENFRTLIVNMARGREWIWINGNHDPDGIVDLPGTSADEMHYAGLTFRHEPKNGLQSGE
FT                   IAGHLHPSATVRRREKSVRRPCFATDGARLLMPAFGLMSGGLDLGHQAMKGLFDKALLV
FT                   AHLLGRDRIYSVRYGNLRG"
     MNRLALARDI SGLAAIPGIE TSVNGIAAVC DPLGALYLPD AGLLVVSDLH LEKGAAFARR        60
     GMMLPPYDTL ATLTVLAAVI SRYDPKLVIS LGDNFHDRIG SKHLPENFRT LIVNMARGRE       120
     WIWINGNHDP DGIVDLPGTS ADEMHYAGLT FRHEPKNGLQ SGEIAGHLHP SATVRRREKS       180
     VRRPCFATDG ARLLMPAFGL MSGGLDLGHQ AMKGLFDKAL LVAHLLGRDR IYSVRYGNLR       240
     G                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page