(data stored in ACNUC7421 zone)

EMBL: CP001622.PE233

CP001622.PE233       Location/Qualifiers
FT   CDS             complement(242782..243363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54545"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00551"
FT                   /protein_id="ACS54545.1"
FT                   /translation="MRTRIVLTAVGLALLAGCATAPKQTRNICAVFDERDGLFSSWQSA
FT                   AERTEKKYGVPVPILMATMYTESGFQPYARPPRTKLFGFIPWTRPSTAYGYSQALDGTW
FT                   DHYQSQTGNWTARRANFADAIDFIGWYHYQNSVETGIPLNDAYNLYLAYYSGPTGYKRG
FT                   DWRSNGQLQQTAQKFARMAGTYQRQLQECD"
     MRTRIVLTAV GLALLAGCAT APKQTRNICA VFDERDGLFS SWQSAAERTE KKYGVPVPIL        60
     MATMYTESGF QPYARPPRTK LFGFIPWTRP STAYGYSQAL DGTWDHYQSQ TGNWTARRAN       120
     FADAIDFIGW YHYQNSVETG IPLNDAYNLY LAYYSGPTGY KRGDWRSNGQ LQQTAQKFAR       180
     MAGTYQRQLQ ECD                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page