(data stored in ACNUC7421 zone)

EMBL: CP001622.PE234

CP001622.PE234       Location/Qualifiers
FT   CDS             complement(243512..244069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0235"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: rec:RHECIAT_CH0000623 putative dihydrofolate
FT                   reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54546"
FT                   /db_xref="GOA:C6B0C7"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C7"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACS54546.1"
FT                   /translation="MRKLIVWNLMTLDGYFEGTKPWDIDFHNLAWGPELQRYAEQFGRE
FT                   SDLLVFGRKTYEGMASYWPTAEGEGEIKTYMNGIAKIAVSRTMSEPGWNNARVVSDPIP
FT                   ELTRLKQEDGKTILIFGSAELADSLLKAGLIDEVRVCLVPVILGGGNPLFKQAEGQLPL
FT                   KLIESSTTEGGAVILRYEPVKA"
     MRKLIVWNLM TLDGYFEGTK PWDIDFHNLA WGPELQRYAE QFGRESDLLV FGRKTYEGMA        60
     SYWPTAEGEG EIKTYMNGIA KIAVSRTMSE PGWNNARVVS DPIPELTRLK QEDGKTILIF       120
     GSAELADSLL KAGLIDEVRV CLVPVILGGG NPLFKQAEGQ LPLKLIESST TEGGAVILRY       180
     EPVKA                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page