(data stored in ACNUC7421 zone)

EMBL: CP001622.PE235

CP001622.PE235       Location/Qualifiers
FT   CDS             complement(244271..245071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54547"
FT                   /db_xref="GOA:C6B0C8"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000624"
FT                   /protein_id="ACS54547.1"
FT                   /translation="MRLAAAFIALLCLLPASAGAQWLPGQATEAVREGLEIGTSTSEIA
FT                   ITSDFHGADLTIFGALSNTDQLLLAVGQYDVVVVLEGPREDATVRKKERVFGIWVNTRS
FT                   MTFEAVPHSYSMSSSRMIDDIVTPLDLTDQGIGIDHIPLTPVGFVGDGSNLGEFREAFR
FT                   RLQQGGGLYDRNPSGVRFVSSNLFKASLRLPANIPNGVHSVRAYLFKSGLFVTEKSLPL
FT                   RVIKTGIEQTITDAAHDQPILYGFAAVLLAVITGWGASLIFRKD"
     MRLAAAFIAL LCLLPASAGA QWLPGQATEA VREGLEIGTS TSEIAITSDF HGADLTIFGA        60
     LSNTDQLLLA VGQYDVVVVL EGPREDATVR KKERVFGIWV NTRSMTFEAV PHSYSMSSSR       120
     MIDDIVTPLD LTDQGIGIDH IPLTPVGFVG DGSNLGEFRE AFRRLQQGGG LYDRNPSGVR       180
     FVSSNLFKAS LRLPANIPNG VHSVRAYLFK SGLFVTEKSL PLRVIKTGIE QTITDAAHDQ       240
     PILYGFAAVL LAVITGWGAS LIFRKD                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page