(data stored in ACNUC7421 zone)

EMBL: CP001622.PE236

CP001622.PE236       Location/Qualifiers
FT   CDS             complement(245071..245994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0237"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   ret:RHE_CH00554 putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54548"
FT                   /db_xref="GOA:C6B0C9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0C9"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACS54548.1"
FT                   /translation="MTIYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGSLDVKLGTVLLVGGLTGATVGIWIFSLL
FT                   RAIGQLDLIISLMYVVFLGTVGGLMLLESINAMRRAARNEPPAPRKPGHQHWVHKLPLK
FT                   VRFKKSKIYLSVIPIVALGFAIGILTSIMGVGGGFIMVPAMIYLLRIPTNVVVGTSLFQ
FT                   IIFVTAYTTIVQAATNFSVDIVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLGLLVL
FT                   AVGVRLAIALVVTPADVYSVVMGAGN"
     MTIYLPIAEL SVNIFIILGM GAAVGFLSGM FGVGGGFLIT PLLIFYNIPP VVAVATGANQ        60
     VVASSISGAI THFRRGSLDV KLGTVLLVGG LTGATVGIWI FSLLRAIGQL DLIISLMYVV       120
     FLGTVGGLML LESINAMRRA ARNEPPAPRK PGHQHWVHKL PLKVRFKKSK IYLSVIPIVA       180
     LGFAIGILTS IMGVGGGFIM VPAMIYLLRI PTNVVVGTSL FQIIFVTAYT TIVQAATNFS       240
     VDIVLAFILM VAGVIGAQYG VRVGQKLRGE QLRALLGLLV LAVGVRLAIA LVVTPADVYS       300
     VVMGAGN                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page