(data stored in ACNUC7421 zone)

EMBL: CP001622.PE237

CP001622.PE237       Location/Qualifiers
FT   CDS             complement(246309..250100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0238"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; Sel1
FT                   domain protein repeat-containing protein; SMART: Sel1
FT                   domain protein repeat-containing protein; KEGG:
FT                   rec:RHECIAT_CH0000627 putative hemaglutinin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54549"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D0"
FT                   /inference="protein motif:PFAM:PF01471"
FT                   /protein_id="ACS54549.1"
FT                   /translation="MNGSRSNPSRQSDRTSLDALNRTIEGLEARIEGLMGSGREQRPRT
FT                   AAAERDPYAASHAPRPAKAPPEPRPDPLAEIRQRQRALEASRERPYAREQAPQLREPAP
FT                   RAAAPVPAPALRAGNDTMTEIAQALVNLRQDLKRDISEGVTREMNALRAELREIKTNAG
FT                   DGRFADDMRADMGRLAQSITQLTGRSVAPEATGLREDFEELRSLMDGLAREDSLRHMEN
FT                   RWDGFENRLAALDTEGLQEELVSLAYRLDDIKRHIGGMGESPAVRALEDKLISIATAME
FT                   HFGNMIQPHDRVMSEQFAAMDMRLDEISRAIAASGRTATTNDPGLMQRLENRLEALADQ
FT                   IDLMSHDAASRVNPADELAMRLEALTGRVEEMTKAEATSRLDERLEHLSYLLERTQETA
FT                   PQADLTGTLSDISRKIDALENGAVNDVLAQRLDHLARRIDEMAHQQQAPAPAAVADDSA
FT                   FLRLEGRLSDIAARLEESTSAAPTDPRALKNLEDQIANLSALMSAPRESAVIPPEFDQR
FT                   MGAIEDYMATSDEYIIEAARQAAEAVVEAYSRHGGPQGVMPAADMSALTALAEDLRHLE
FT                   DLSRDSEERTHKTFQALHETLVHIADRLDGMEDRGRPLAQMPVADVDFDVDPYALMVAE
FT                   AELNRTPATAQTAKASPVIRTAEVAAEPAAPAQATAMSGTSAIAIEAATRTTEVATAAR
FT                   AQAPAKASLLASLGKRLLPGKKAESRATERPMIDPAPSIDPTDVVPTDAANELLEPGSG
FT                   APDVKKILERVRASQSAARGKPAGETDRADYIAAARRAAQAAAMEVDANPKQAAVKAEK
FT                   KGANADKAGKTSDKTGKTSAFSRYRRPILLAVGAVLLAIMAFPLARTLTSGERAPQPPA
FT                   EVSALTGAAENPAPPLPEATPAQPDAAALGTTAPAAEAVPPAAEQAQPEATPPDAGEHL
FT                   TDVAPLDGEGAATLAPPGPSGAAQETSGFVPNAPAAAAPAPAITIPDTVQPKSLADAAS
FT                   SGDTLALFEIGARYSDGRNGMTVDQKQAASWYQLAADKGFAPAQYRLGSMYEKGNGVER
FT                   DITKAKGFYEQAANQGNASAMHNLAVLYASGALGQQDYATAAAWFTKAANLGITDSQFN
FT                   LAILCARGNGVPADLEESYKWFAIAAKGGDKDAAQKRDEVAKAMKPDQLERARAKADLW
FT                   KPEPVDHRTNAIDIPDEWAGTGAKTASVDMKKAVRNIQAILNNNGFDAGVPDGEMGAKT
FT                   VTAIKNFQKSVGQEPDGKVTDATVKALLERNKQAGKAI"
     MNGSRSNPSR QSDRTSLDAL NRTIEGLEAR IEGLMGSGRE QRPRTAAAER DPYAASHAPR        60
     PAKAPPEPRP DPLAEIRQRQ RALEASRERP YAREQAPQLR EPAPRAAAPV PAPALRAGND       120
     TMTEIAQALV NLRQDLKRDI SEGVTREMNA LRAELREIKT NAGDGRFADD MRADMGRLAQ       180
     SITQLTGRSV APEATGLRED FEELRSLMDG LAREDSLRHM ENRWDGFENR LAALDTEGLQ       240
     EELVSLAYRL DDIKRHIGGM GESPAVRALE DKLISIATAM EHFGNMIQPH DRVMSEQFAA       300
     MDMRLDEISR AIAASGRTAT TNDPGLMQRL ENRLEALADQ IDLMSHDAAS RVNPADELAM       360
     RLEALTGRVE EMTKAEATSR LDERLEHLSY LLERTQETAP QADLTGTLSD ISRKIDALEN       420
     GAVNDVLAQR LDHLARRIDE MAHQQQAPAP AAVADDSAFL RLEGRLSDIA ARLEESTSAA       480
     PTDPRALKNL EDQIANLSAL MSAPRESAVI PPEFDQRMGA IEDYMATSDE YIIEAARQAA       540
     EAVVEAYSRH GGPQGVMPAA DMSALTALAE DLRHLEDLSR DSEERTHKTF QALHETLVHI       600
     ADRLDGMEDR GRPLAQMPVA DVDFDVDPYA LMVAEAELNR TPATAQTAKA SPVIRTAEVA       660
     AEPAAPAQAT AMSGTSAIAI EAATRTTEVA TAARAQAPAK ASLLASLGKR LLPGKKAESR       720
     ATERPMIDPA PSIDPTDVVP TDAANELLEP GSGAPDVKKI LERVRASQSA ARGKPAGETD       780
     RADYIAAARR AAQAAAMEVD ANPKQAAVKA EKKGANADKA GKTSDKTGKT SAFSRYRRPI       840
     LLAVGAVLLA IMAFPLARTL TSGERAPQPP AEVSALTGAA ENPAPPLPEA TPAQPDAAAL       900
     GTTAPAAEAV PPAAEQAQPE ATPPDAGEHL TDVAPLDGEG AATLAPPGPS GAAQETSGFV       960
     PNAPAAAAPA PAITIPDTVQ PKSLADAASS GDTLALFEIG ARYSDGRNGM TVDQKQAASW      1020
     YQLAADKGFA PAQYRLGSMY EKGNGVERDI TKAKGFYEQA ANQGNASAMH NLAVLYASGA      1080
     LGQQDYATAA AWFTKAANLG ITDSQFNLAI LCARGNGVPA DLEESYKWFA IAAKGGDKDA      1140
     AQKRDEVAKA MKPDQLERAR AKADLWKPEP VDHRTNAIDI PDEWAGTGAK TASVDMKKAV      1200
     RNIQAILNNN GFDAGVPDGE MGAKTVTAIK NFQKSVGQEP DGKVTDATVK ALLERNKQAG      1260
     KAI                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page