(data stored in ACNUC7421 zone)

EMBL: CP001622.PE238

CP001622.PE238       Location/Qualifiers
FT   CDS             complement(250427..250792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0239"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rec:RHECIAT_CH0000628 putative
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54550"
FT                   /db_xref="GOA:C6B0D1"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54550.1"
FT                   /translation="MPRLDHVTIETRDAPVMIGFLETLLGVREGYRPPFASPGHWLYLD
FT                   ECPVIHLSLTSRSTDFPPGIFNHVAFSLYEFEPALERIKATGYRYEYYDIPDTDLGQVF
FT                   VYGPEGVKIELQYPRPA"
     MPRLDHVTIE TRDAPVMIGF LETLLGVREG YRPPFASPGH WLYLDECPVI HLSLTSRSTD        60
     FPPGIFNHVA FSLYEFEPAL ERIKATGYRY EYYDIPDTDL GQVFVYGPEG VKIELQYPRP       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page