(data stored in ACNUC7421 zone)

EMBL: CP001622.PE239

CP001622.PE239       Location/Qualifiers
FT   CDS             complement(250879..251580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0240"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bja:blr7900 putative nodulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54551"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54551.1"
FT                   /translation="MTDFPYESALIVGAGSGISASLARQLSAQGVKVGLAARNIEKLQG
FT                   LIEETGASAFTTDVSQPASVAALFEEAAAAIGGPDVVIFNASARQRGPLAELDPADVEK
FT                   AIATSAFGGFLVVQQAARRMIPRGRGAILITGASASVKGFAQSAPFAMGKFALRGLAQS
FT                   AARELGPMGIHVAHFVIDGAVRSQIRPDRVEKPDGTLLPEAIAQTYIDVLRQHRSAWSL
FT                   EVEVRPWTESF"
     MTDFPYESAL IVGAGSGISA SLARQLSAQG VKVGLAARNI EKLQGLIEET GASAFTTDVS        60
     QPASVAALFE EAAAAIGGPD VVIFNASARQ RGPLAELDPA DVEKAIATSA FGGFLVVQQA       120
     ARRMIPRGRG AILITGASAS VKGFAQSAPF AMGKFALRGL AQSAARELGP MGIHVAHFVI       180
     DGAVRSQIRP DRVEKPDGTL LPEAIAQTYI DVLRQHRSAW SLEVEVRPWT ESF              233
//

If you have problems or comments...

PBIL Back to PBIL home page